SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452227|ref|YP_007719975.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452227|ref|YP_007719975.1|
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily Glu-tRNAGln amidotransferase C subunit 5.36e-16
Family Glu-tRNAGln amidotransferase C subunit 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452227|ref|YP_007719975.1|
Sequence length 100
Comment aspartyl/glutamyl-tRNA amidotransferase subunit C [Chlamydia trachomatis L2b/Canada1]
Sequence
MTESYVNKEEIISLAKNAALELEDAHVEEFVTSMNDVIALMQEVIAIDISDIILEATVHH
FVGPEDLREDMVTSDFTQEEFLSNVPVSLGGLVKVPTVIK
Download sequence
Identical sequences A0A0E9CCJ7 B0B9A9 B0BAY8 G4NNV0 O84005 Q3KN20
gi|478472063|ref|YP_007732630.1| gi|527327369|ref|YP_008353560.1| gi|478462167|ref|YP_007737988.1| gi|478457653|ref|YP_007730838.1| gi|385244090|ref|YP_005811934.1| gi|478449528|ref|YP_007719085.1| gi|478454934|ref|YP_007727124.1| gi|385269644|ref|YP_005812804.1| gi|478460357|ref|YP_007735308.1| gi|482545356|ref|YP_007851274.1| gi|478472967|ref|YP_007734415.1| gi|527323461|ref|YP_008349657.1| gi|527326449|ref|YP_008352641.1| gi|76788714|ref|YP_327800.1| gi|478447726|ref|YP_007721760.1| gi|478470272|ref|YP_007728913.1| gi|568111255|ref|YP_008920852.1| gi|478461252|ref|YP_007736202.1| gi|478448619|ref|YP_007723542.1| gi|527322504|ref|YP_008348701.1| gi|478463066|ref|YP_007738878.1| gi|478464864|ref|YP_007741546.1| gi|527324597|ref|YP_008350791.1| gi|15604720|ref|NP_219504.1| gi|527325522|ref|YP_008351715.1| gi|471328178|ref|YP_007539703.1| gi|478453141|ref|YP_007717303.1| gi|478456742|ref|YP_007725335.1| gi|478451328|ref|YP_007714634.1| gi|166155098|ref|YP_001653353.1| gi|478466663|ref|YP_007718195.1| gi|385244970|ref|YP_005813793.1| gi|478459456|ref|YP_007733524.1| gi|527321568|ref|YP_008347766.1| gi|385242288|ref|YP_005810127.1| gi|478452227|ref|YP_007719975.1| gi|478469372|ref|YP_007722652.1| gi|339625644|ref|YP_004717123.1| gi|385245898|ref|YP_005814720.1| gi|166154223|ref|YP_001654341.1| gi|527328296|ref|YP_008354486.1| gi|478463964|ref|YP_007740656.1| gi|386262360|ref|YP_005815639.1| gi|482546298|ref|YP_007852214.1| gi|389858574|ref|YP_006360815.1| gi|478467563|ref|YP_007742436.1| gi|478446835|ref|YP_007715523.1| gi|478450428|ref|YP_007720870.1| gi|385240433|ref|YP_005808274.1| gi|478455844|ref|YP_007726227.1| gi|478471163|ref|YP_007739766.1| gi|389857700|ref|YP_006359942.1| gi|385241361|ref|YP_005809201.1| gi|389859451|ref|YP_006361691.1| NP_219504.1.57406 WP_009871348.1.100466 WP_009871348.1.100644 WP_009871348.1.100883 WP_009871348.1.101362 WP_009871348.1.101735 WP_009871348.1.102133 WP_009871348.1.11148 WP_009871348.1.11717 WP_009871348.1.11732 WP_009871348.1.13674 WP_009871348.1.13837 WP_009871348.1.1409 WP_009871348.1.14786 WP_009871348.1.14984 WP_009871348.1.15381 WP_009871348.1.17082 WP_009871348.1.17422 WP_009871348.1.18643 WP_009871348.1.1923 WP_009871348.1.19304 WP_009871348.1.20022 WP_009871348.1.20093 WP_009871348.1.22210 WP_009871348.1.25195 WP_009871348.1.25246 WP_009871348.1.27753 WP_009871348.1.27980 WP_009871348.1.28239 WP_009871348.1.29171 WP_009871348.1.30792 WP_009871348.1.31128 WP_009871348.1.31373 WP_009871348.1.32156 WP_009871348.1.32801 WP_009871348.1.32856 WP_009871348.1.34934 WP_009871348.1.35043 WP_009871348.1.36244 WP_009871348.1.36518 WP_009871348.1.3661 WP_009871348.1.37417 WP_009871348.1.37673 WP_009871348.1.37956 WP_009871348.1.38181 WP_009871348.1.38504 WP_009871348.1.38794 WP_009871348.1.38813 WP_009871348.1.40272 WP_009871348.1.40464 WP_009871348.1.40808 WP_009871348.1.4187 WP_009871348.1.4264 WP_009871348.1.42718 WP_009871348.1.42889 WP_009871348.1.43504 WP_009871348.1.44223 WP_009871348.1.45552 WP_009871348.1.48551 WP_009871348.1.48923 WP_009871348.1.4939 WP_009871348.1.49465 WP_009871348.1.5036 WP_009871348.1.51159 WP_009871348.1.51530 WP_009871348.1.52091 WP_009871348.1.53299 WP_009871348.1.5416 WP_009871348.1.55117 WP_009871348.1.57520 WP_009871348.1.57533 WP_009871348.1.58046 WP_009871348.1.58308 WP_009871348.1.5967 WP_009871348.1.60427 WP_009871348.1.60937 WP_009871348.1.61004 WP_009871348.1.6151 WP_009871348.1.61683 WP_009871348.1.62239 WP_009871348.1.62489 WP_009871348.1.62968 WP_009871348.1.64162 WP_009871348.1.65182 WP_009871348.1.65391 WP_009871348.1.66489 WP_009871348.1.67250 WP_009871348.1.69355 WP_009871348.1.69519 WP_009871348.1.69991 WP_009871348.1.71307 WP_009871348.1.71619 WP_009871348.1.71686 WP_009871348.1.72034 WP_009871348.1.72164 WP_009871348.1.72442 WP_009871348.1.74323 WP_009871348.1.74635 WP_009871348.1.75470 WP_009871348.1.77153 WP_009871348.1.77651 WP_009871348.1.79775 WP_009871348.1.83525 WP_009871348.1.83642 WP_009871348.1.85256 WP_009871348.1.85365 WP_009871348.1.86066 WP_009871348.1.87079 WP_009871348.1.87298 WP_009871348.1.87666 WP_009871348.1.88177 WP_009871348.1.88937 WP_009871348.1.9107 WP_009871348.1.92427 WP_009871348.1.93216 WP_009871348.1.9343 WP_009871348.1.93600 WP_009871348.1.95142 WP_009871348.1.96955 WP_009871348.1.97423 WP_009871348.1.97602 WP_009871348.1.99598 YP_001654341.1.27483 gi|385243210|ref|YP_005811056.1| gi|478474772|ref|YP_007724441.1| gi|478428138|ref|YP_007540578.1| gi|527317814|ref|YP_008344016.1| gi|385239512|ref|YP_005807354.1| gi|478473870|ref|YP_007729946.1| gi|527319695|ref|YP_008345895.1| gi|478458546|ref|YP_007731730.1| gi|385269644|ref|YP_005812804.1| gi|237802436|ref|YP_002887630.1| gi|237804351|ref|YP_002888505.1| gi|478454034|ref|YP_007716413.1| 272561.CT002 315277.CTA_0003 471472.CTL0257 471473.CTLon_0252 580049.JALI_0021 672161.CTB_0021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]