SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452251|ref|YP_007719999.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452251|ref|YP_007719999.1|
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily Ribosomal protein S16 1.05e-24
Family Ribosomal protein S16 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452251|ref|YP_007719999.1|
Sequence length 116
Comment 30S ribosomal protein S16 [Chlamydia trachomatis L2b/Canada1]
Sequence
MALKIRLRQQGRKNHVVYRLVLADVESPRDGKYIELLGWYDPHSEQNYQLKSERIFYWLN
QGAELTEKAGALVKQGAPGVYAELMAKKVARRAVVRQKRRAYRQRLAARKAEAAAK
Download sequence
Identical sequences A0A0E9AYB0 B0B9D3 B0BB12 O84029
gi|478457677|ref|YP_007730862.1| gi|478450452|ref|YP_007720894.1| gi|478471187|ref|YP_007739790.1| gi|166155122|ref|YP_001653377.1| gi|482545382|ref|YP_007851300.1| gi|527317839|ref|YP_008344041.1| gi|478453165|ref|YP_007717327.1| gi|478464888|ref|YP_007741570.1| 272561.CT026 471472.CTL0281 471473.CTLon_0276 gi|385244114|ref|YP_005811958.1| gi|478469396|ref|YP_007722676.1| gi|385240458|ref|YP_005808299.1| gi|527326474|ref|YP_008352666.1| gi|527319720|ref|YP_008345920.1| gi|15604744|ref|NP_219528.1| NP_219528.1.57406 WP_009871373.1.100883 WP_009871373.1.101362 WP_009871373.1.101735 WP_009871373.1.102133 WP_009871373.1.11148 WP_009871373.1.11732 WP_009871373.1.13674 WP_009871373.1.14984 WP_009871373.1.17082 WP_009871373.1.18643 WP_009871373.1.20093 WP_009871373.1.22210 WP_009871373.1.25195 WP_009871373.1.27753 WP_009871373.1.27980 WP_009871373.1.30792 WP_009871373.1.32801 WP_009871373.1.34934 WP_009871373.1.38181 WP_009871373.1.38504 WP_009871373.1.38794 WP_009871373.1.40464 WP_009871373.1.40808 WP_009871373.1.4264 WP_009871373.1.42718 WP_009871373.1.45552 WP_009871373.1.48923 WP_009871373.1.49465 WP_009871373.1.5036 WP_009871373.1.51159 WP_009871373.1.52091 WP_009871373.1.53299 WP_009871373.1.5416 WP_009871373.1.55117 WP_009871373.1.58046 WP_009871373.1.58308 WP_009871373.1.5967 WP_009871373.1.60427 WP_009871373.1.61004 WP_009871373.1.62489 WP_009871373.1.64162 WP_009871373.1.65391 WP_009871373.1.67250 WP_009871373.1.69355 WP_009871373.1.71307 WP_009871373.1.71619 WP_009871373.1.72034 WP_009871373.1.72442 WP_009871373.1.74323 WP_009871373.1.75470 WP_009871373.1.77651 WP_009871373.1.79775 WP_009871373.1.83642 WP_009871373.1.85365 WP_009871373.1.86066 WP_009871373.1.87079 WP_009871373.1.93216 WP_009871373.1.95142 WP_009871373.1.97423 WP_009871373.1.99598 YP_001654365.1.27483 gi|478454058|ref|YP_007716437.1| gi|527322529|ref|YP_008348726.1| gi|527325546|ref|YP_008351739.1| gi|478474796|ref|YP_007724465.1| gi|478463090|ref|YP_007738902.1| gi|478456766|ref|YP_007725359.1| gi|385243234|ref|YP_005811080.1| gi|482546324|ref|YP_007852240.1| gi|478452251|ref|YP_007719999.1| gi|527324622|ref|YP_008350816.1| gi|339625671|ref|YP_004717150.1| gi|478446859|ref|YP_007715547.1| gi|478454958|ref|YP_007727148.1| gi|478466687|ref|YP_007718219.1| gi|478470296|ref|YP_007728937.1| gi|166154247|ref|YP_001654365.1| gi|478449552|ref|YP_007719109.1| gi|478463988|ref|YP_007740680.1| gi|478451352|ref|YP_007714658.1| gi|478459480|ref|YP_007733548.1| gi|527323487|ref|YP_008349683.1| gi|527321593|ref|YP_008347791.1| gi|478460381|ref|YP_007735332.1| gi|478462191|ref|YP_007738012.1| gi|527327395|ref|YP_008353586.1| gi|527328322|ref|YP_008354512.1| gi|478447750|ref|YP_007721784.1| gi|478467587|ref|YP_007742460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]