SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452253|ref|YP_007720001.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452253|ref|YP_007720001.1|
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.61e-37
Family Ribosomal protein L19 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452253|ref|YP_007720001.1|
Sequence length 121
Comment 50S ribosomal protein L19 [Chlamydia trachomatis L2b/Canada1]
Sequence
MGNLIKELQDEQCRTDLADFCVGDTIRVATNISEGGKERVQVFQGTVMARKGGGAGETVS
LHRVAYGEGMEKSFLLNSPKIVSIEVVKRGKVSRARLFYLRGKTGKAAKVKELIGSRAAK
K
Download sequence
Identical sequences A0A0E9AX45 B0B9D5 B0BB14 G4NNX9 O84031 Q3KMZ4
gi|385245925|ref|YP_005814747.1| gi|471328204|ref|YP_007539729.1| gi|478460383|ref|YP_007735334.1| gi|478466689|ref|YP_007718221.1| gi|478464890|ref|YP_007741572.1| gi|527328324|ref|YP_008354514.1| gi|527318767|ref|YP_008344968.1| gi|478474798|ref|YP_007724467.1| gi|527322531|ref|YP_008348728.1| gi|527324624|ref|YP_008350818.1| gi|478461278|ref|YP_007736228.1| gi|15604746|ref|NP_219530.1| gi|478454960|ref|YP_007727150.1| gi|76788740|ref|YP_327826.1| gi|386262385|ref|YP_005815664.1| gi|478450454|ref|YP_007720896.1| gi|478455870|ref|YP_007726253.1| gi|389859477|ref|YP_006361717.1| gi|385241388|ref|YP_005809228.1| 272561.CT028 315277.CTA_0030 471472.CTL0283 471473.CTLon_0278 580049.JALI_0281 672161.CTB_0281 gi|478463092|ref|YP_007738904.1| gi|478447752|ref|YP_007721786.1| gi|478473896|ref|YP_007729972.1| gi|478456768|ref|YP_007725361.1| gi|385243236|ref|YP_005811082.1| gi|482545384|ref|YP_007851302.1| gi|478457679|ref|YP_007730864.1| gi|527319722|ref|YP_008345922.1| gi|385240460|ref|YP_005808301.1| gi|527323489|ref|YP_008349685.1| gi|482546326|ref|YP_007852242.1| gi|385239539|ref|YP_005807381.1| gi|527321595|ref|YP_008347793.1| gi|478472089|ref|YP_007732656.1| gi|385269673|ref|YP_005812833.1| gi|478470298|ref|YP_007728939.1| gi|478463990|ref|YP_007740682.1| gi|385244997|ref|YP_005813820.1| gi|478449554|ref|YP_007719111.1| gi|237802462|ref|YP_002887656.1| gi|166154249|ref|YP_001654367.1| gi|339625673|ref|YP_004717152.1| gi|478471189|ref|YP_007739792.1| gi|385269673|ref|YP_005812833.1| gi|527326476|ref|YP_008352668.1| gi|385244116|ref|YP_005811960.1| gi|478454060|ref|YP_007716439.1| gi|237804377|ref|YP_002888531.1| gi|478428164|ref|YP_007540604.1| gi|478453167|ref|YP_007717329.1| gi|385242315|ref|YP_005810154.1| gi|389857726|ref|YP_006359968.1| gi|478469398|ref|YP_007722678.1| gi|478462193|ref|YP_007738014.1| gi|478458572|ref|YP_007731756.1| gi|478459482|ref|YP_007733550.1| gi|527317841|ref|YP_008344043.1| gi|478472993|ref|YP_007734441.1| NP_219530.1.57406 WP_009871375.1.100466 WP_009871375.1.100644 WP_009871375.1.100883 WP_009871375.1.101362 WP_009871375.1.101735 WP_009871375.1.102133 WP_009871375.1.11148 WP_009871375.1.11717 WP_009871375.1.11732 WP_009871375.1.13674 WP_009871375.1.13766 WP_009871375.1.13837 WP_009871375.1.1409 WP_009871375.1.14786 WP_009871375.1.14984 WP_009871375.1.15381 WP_009871375.1.17082 WP_009871375.1.17422 WP_009871375.1.18643 WP_009871375.1.1923 WP_009871375.1.19304 WP_009871375.1.20022 WP_009871375.1.20093 WP_009871375.1.22210 WP_009871375.1.25195 WP_009871375.1.25246 WP_009871375.1.27753 WP_009871375.1.27980 WP_009871375.1.28239 WP_009871375.1.29171 WP_009871375.1.30792 WP_009871375.1.31128 WP_009871375.1.31373 WP_009871375.1.32156 WP_009871375.1.32801 WP_009871375.1.32856 WP_009871375.1.34934 WP_009871375.1.35043 WP_009871375.1.36244 WP_009871375.1.36518 WP_009871375.1.3661 WP_009871375.1.37417 WP_009871375.1.37673 WP_009871375.1.37956 WP_009871375.1.38181 WP_009871375.1.38504 WP_009871375.1.38794 WP_009871375.1.38813 WP_009871375.1.39258 WP_009871375.1.40272 WP_009871375.1.40464 WP_009871375.1.40808 WP_009871375.1.4187 WP_009871375.1.4264 WP_009871375.1.42718 WP_009871375.1.43504 WP_009871375.1.44223 WP_009871375.1.45552 WP_009871375.1.48551 WP_009871375.1.48923 WP_009871375.1.4939 WP_009871375.1.49465 WP_009871375.1.5036 WP_009871375.1.51159 WP_009871375.1.51530 WP_009871375.1.52091 WP_009871375.1.53299 WP_009871375.1.5416 WP_009871375.1.55117 WP_009871375.1.57520 WP_009871375.1.57533 WP_009871375.1.58046 WP_009871375.1.58308 WP_009871375.1.5967 WP_009871375.1.60427 WP_009871375.1.60937 WP_009871375.1.61004 WP_009871375.1.6151 WP_009871375.1.61683 WP_009871375.1.62239 WP_009871375.1.62489 WP_009871375.1.62510 WP_009871375.1.62968 WP_009871375.1.64162 WP_009871375.1.65182 WP_009871375.1.65391 WP_009871375.1.66489 WP_009871375.1.67104 WP_009871375.1.67250 WP_009871375.1.69355 WP_009871375.1.69519 WP_009871375.1.69991 WP_009871375.1.71307 WP_009871375.1.71619 WP_009871375.1.71686 WP_009871375.1.72034 WP_009871375.1.72164 WP_009871375.1.72442 WP_009871375.1.74323 WP_009871375.1.74635 WP_009871375.1.75470 WP_009871375.1.77153 WP_009871375.1.77651 WP_009871375.1.78375 WP_009871375.1.79775 WP_009871375.1.83525 WP_009871375.1.83642 WP_009871375.1.85256 WP_009871375.1.85365 WP_009871375.1.86066 WP_009871375.1.87079 WP_009871375.1.87298 WP_009871375.1.87666 WP_009871375.1.88177 WP_009871375.1.88937 WP_009871375.1.9107 WP_009871375.1.92427 WP_009871375.1.93216 WP_009871375.1.9343 WP_009871375.1.93600 WP_009871375.1.95142 WP_009871375.1.96955 WP_009871375.1.97423 WP_009871375.1.97602 WP_009871375.1.99598 YP_001654367.1.27483 gi|478446861|ref|YP_007715549.1| gi|478451354|ref|YP_007714660.1| gi|478452253|ref|YP_007720001.1| gi|527320643|ref|YP_008346842.1| gi|478448645|ref|YP_007723568.1| gi|166155124|ref|YP_001653379.1| gi|389858599|ref|YP_006360840.1| gi|527327397|ref|YP_008353588.1| gi|527325548|ref|YP_008351741.1| gi|478467589|ref|YP_007742462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]