SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452281|ref|YP_007720029.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452281|ref|YP_007720029.1|
Domain Number 1 Region: 503-594
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-16
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.004
Further Details:      
 
Weak hits

Sequence:  gi|478452281|ref|YP_007720029.1|
Domain Number - Region: 38-210
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 0.00541
Family Dihydropteroate synthetase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452281|ref|YP_007720029.1|
Sequence length 602
Comment 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia trachomatis L2b/Canada1]
Sequence
MATPCIQNAFRRKTLPVRIGDLFVGSEHSIKIQSMTTTATTDVDGTVRQICALQEWGCDI
VRVTVQGLREVHACEHIKDRLIQQNISIPLVADIHFFPQAAIHVVDCVDKVRINPGNYVD
KRNMFTGKIYSDEQYAHSLEHLMNKFSPLVEKCKRLGKAMRIGVNHGSLSERVTQRYGNT
IEGMVYSALEYAEVCVAMDYHDVIFSMKSSNPKVMVAAYRSLAYELDQREWSYPLHLGVT
EAGSGTAGIVKSAVGIGTLLSEGLGDTIRCSLTGSPINEIPICIDLLKQTTELSERWGEA
DNPFAIHSSKQLGTRNTLNTPPWGNVYGLLINLTDVQLLTAEPIELLQCLGIDTTTGKID
PTTPEGVVVPKAMRSSPIVSEIEKHLLVFNKEDAPILNPMNEEEWLSEETLSAPFVYFEV
TDIHTARRFFSLRQHSTQPVCLSFSLDPHLSKNEAIIDLSARLGALLLDGLGSCVLLDFV
DIKLSRTLGFLILQSANIRSVTVEYVSCPGCGRTLFDLLAVSQRIRERTKHLPGGLKIAV
MGCIVNGPGEMADADFGYVGSKPGMIDLYVKHKCVKSCIPIENAEEELVQLLKEHGVWKE
PE
Download sequence
Identical sequences A0A0E9G264 B0BB44
gi|478470326|ref|YP_007728967.1| 471473.CTLon_0308 gi|478464918|ref|YP_007741600.1| gi|478449582|ref|YP_007719139.1| gi|478464018|ref|YP_007740710.1| gi|478454088|ref|YP_007716467.1| WP_012263592.1.101735 WP_012263592.1.18643 WP_012263592.1.25195 WP_012263592.1.27753 WP_012263592.1.38794 WP_012263592.1.40464 WP_012263592.1.42718 WP_012263592.1.45552 WP_012263592.1.48923 WP_012263592.1.5416 WP_012263592.1.58308 WP_012263592.1.5967 WP_012263592.1.79775 WP_012263592.1.97423 gi|478450482|ref|YP_007720924.1| gi|478466717|ref|YP_007718249.1| gi|478469426|ref|YP_007722706.1| gi|478471217|ref|YP_007739820.1| gi|478452281|ref|YP_007720029.1| gi|478453195|ref|YP_007717357.1| gi|478467617|ref|YP_007742490.1| gi|166155153|ref|YP_001653408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]