SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452285|ref|YP_007720033.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452285|ref|YP_007720033.1|
Domain Number 1 Region: 8-97
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 2.83e-25
Family Sigma2 domain of RNA polymerase sigma factors 0.00065
Further Details:      
 
Domain Number 2 Region: 163-250
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 2.8e-21
Family Sigma4 domain 0.0068
Further Details:      
 
Domain Number 3 Region: 98-176
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000000000000698
Family Sigma3 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452285|ref|YP_007720033.1|
Sequence length 253
Comment RNA polymerase sigma factor sigma-28 [Chlamydia trachomatis L2b/Canada1]
Sequence
MKTHDLADTWQLYWSTKEIHHRDVLIESYLPLVKNVAHRLASGMPSHVKMEDLYALGVEG
LIRAVERFDPEKSKRFESYALFIIKAAIIDGLRKQDWVPRSVYQRANRLADAMDSLRQTL
GKEPTDGELCEYLNISQQELSHWFSSSRPALVLSLNDDFSCQDDDEGLALEERIADERAE
TGYDVIRKKEAISILTEALLALDEKERQVMALYYYDDLVLKEIGKILGVSESRVSQIHSK
ALLKLRGTLSSLL
Download sequence
Identical sequences A0A0E9B0Y4 A0A0H3MBK6
gi|527317876|ref|YP_008344078.1| gi|166154282|ref|YP_001654400.1| gi|478471221|ref|YP_007739824.1| gi|527325583|ref|YP_008351776.1| gi|478462225|ref|YP_007738046.1| gi|478463124|ref|YP_007738936.1| gi|527321629|ref|YP_008347827.1| gi|478449586|ref|YP_007719143.1| gi|478450486|ref|YP_007720928.1| gi|478464022|ref|YP_007740714.1| gi|527328359|ref|YP_008354549.1| gi|478453199|ref|YP_007717361.1| WP_009873529.1.100883 WP_009873529.1.101735 WP_009873529.1.11148 WP_009873529.1.11732 WP_009873529.1.17082 WP_009873529.1.18643 WP_009873529.1.22210 WP_009873529.1.25195 WP_009873529.1.27753 WP_009873529.1.27980 WP_009873529.1.32801 WP_009873529.1.38181 WP_009873529.1.38794 WP_009873529.1.40464 WP_009873529.1.40808 WP_009873529.1.42718 WP_009873529.1.45552 WP_009873529.1.48923 WP_009873529.1.49465 WP_009873529.1.51159 WP_009873529.1.53299 WP_009873529.1.5416 WP_009873529.1.58046 WP_009873529.1.58308 WP_009873529.1.5967 WP_009873529.1.60427 WP_009873529.1.61004 WP_009873529.1.62489 WP_009873529.1.64162 WP_009873529.1.71307 WP_009873529.1.79775 WP_009873529.1.83642 WP_009873529.1.85365 WP_009873529.1.87079 WP_009873529.1.95142 WP_009873529.1.97423 WP_009873529.1.99598 YP_001654400.1.27483 gi|478469430|ref|YP_007722710.1| gi|478454092|ref|YP_007716471.1| 471472.CTL0317 471473.CTLon_0312 gi|482545419|ref|YP_007851337.1| gi|339625713|ref|YP_004717192.1| gi|478451386|ref|YP_007714692.1| gi|166155157|ref|YP_001653412.1| gi|527323524|ref|YP_008349720.1| gi|527319757|ref|YP_008345957.1| gi|527326511|ref|YP_008352703.1| gi|478464922|ref|YP_007741604.1| gi|478466721|ref|YP_007718253.1| gi|478446893|ref|YP_007715581.1| gi|527324659|ref|YP_008350853.1| gi|478452285|ref|YP_007720033.1| gi|478467621|ref|YP_007742494.1| gi|478470330|ref|YP_007728971.1| gi|527327432|ref|YP_008353623.1| gi|478447784|ref|YP_007721818.1| gi|482546361|ref|YP_007852277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]