SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452311|ref|YP_007720059.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452311|ref|YP_007720059.1|
Domain Number 1 Region: 29-522
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.21e-124
Family Amylase, catalytic domain 0.00000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452311|ref|YP_007720059.1|
Sequence length 527
Comment 4-alpha-glucanotransferase [Chlamydia trachomatis L2b/Canada1]
Sequence
MPSLSQSRRIIQQSSIRKIWNQIDTSPKHGVCVPLFSLHTQESCGIGEFLDLIPMIDWCI
SCGFQILQILPINDTGSCSSPYNSISSIALNPLHLSISALPYKEEVPAAETRIREMQQLS
QLPQVHYEKVRSMKRDFFQEYYRVCKQKKLTDHPDFYAFCEQEKYWLHPYALFRSIREHL
DNLPINHWPTTYTDLSQITEHERTFAEDIQFHSYLQYLCFQQMTQVREHANCKSCLIKGD
IPILISKDSCDVWFYRHYFSSSESVGAPPDLYNAEGQNWHLPIYNMKTLQQDNYLWWKER
LRYAENFYSLYRLDHIVGLFRFWVWDESGCGRFEPHDPKDYLAQGQDILSHLLTSSSMLP
IGEDLGTIPSDVKRMLESFAVCGTRIPRWERNWEGNGAYTPFDQYDPLSVTSLSTHDSST
LASWWKESPQESKLFAQFLGLPYSSTLSLHNHTEILKLSHKTSSIFRINLINDYLALFPD
LISKTPRYERINLPGTISKNNWVYRVKPSIEDLSSHSKLNSLLEALF
Download sequence
Identical sequences A0A0E9AWX5 A0A0H3MBM2
gi|478469454|ref|YP_007722734.1| WP_009873546.1.100883 WP_009873546.1.101735 WP_009873546.1.11148 WP_009873546.1.11732 WP_009873546.1.17082 WP_009873546.1.18643 WP_009873546.1.25195 WP_009873546.1.27753 WP_009873546.1.27980 WP_009873546.1.38794 WP_009873546.1.40464 WP_009873546.1.40808 WP_009873546.1.42718 WP_009873546.1.45552 WP_009873546.1.48923 WP_009873546.1.49465 WP_009873546.1.5416 WP_009873546.1.58046 WP_009873546.1.58308 WP_009873546.1.5967 WP_009873546.1.60427 WP_009873546.1.61004 WP_009873546.1.62489 WP_009873546.1.64162 WP_009873546.1.71307 WP_009873546.1.79775 WP_009873546.1.83642 WP_009873546.1.85365 WP_009873546.1.87079 WP_009873546.1.95142 WP_009873546.1.97423 WP_009873546.1.99598 YP_001654426.1.27483 gi|478450510|ref|YP_007720952.1| gi|166154308|ref|YP_001654426.1| gi|478471245|ref|YP_007739848.1| gi|478466745|ref|YP_007718277.1| gi|527328385|ref|YP_008354575.1| gi|478467645|ref|YP_007742518.1| gi|166155183|ref|YP_001653438.1| gi|478454116|ref|YP_007716495.1| gi|527323550|ref|YP_008349746.1| gi|478449610|ref|YP_007719167.1| gi|478446917|ref|YP_007715605.1| gi|478470354|ref|YP_007728995.1| gi|482545445|ref|YP_007851363.1| gi|478464946|ref|YP_007741628.1| gi|527327458|ref|YP_008353649.1| gi|339625738|ref|YP_004717217.1| gi|478462249|ref|YP_007738070.1| gi|482546387|ref|YP_007852303.1| 471472.CTL0342 471473.CTLon_0338 gi|478452311|ref|YP_007720059.1| gi|527324685|ref|YP_008350879.1| gi|527319783|ref|YP_008345983.1| gi|478453223|ref|YP_007717385.1| gi|478464046|ref|YP_007740738.1| gi|527317902|ref|YP_008344104.1| gi|478451410|ref|YP_007714716.1| gi|527325609|ref|YP_008351802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]