SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452318|ref|YP_007720066.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452318|ref|YP_007720066.1|
Domain Number 1 Region: 8-218
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.75e-72
Family Pseudouridine synthase II TruB 0.00000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452318|ref|YP_007720066.1|
Sequence length 241
Comment tRNA pseudouridine synthase B [Chlamydia trachomatis L2b/Canada1]
Sequence
MELATESIEGVLLVDKPQGRTSFSLIRSLVRLIGVKKIGHAGTLDPFATGVMVMLIGRKF
TRLSDIMLFEDKEYAAVAHLGTTTDTYDCDGKIVGRSKKVPTMDEVLTCTSYFQGEIQQV
PPMFSAKKVQGKKLYEYARQGLSIERRFATVTVNLRLVKYEYPRLHFVVQCSKGTYIRSI
AHELGNMLGCGAYLEELRRLRSGSFSIDQCIDGNLLDEPEFNVSPYLRDANGLILQPAPV
L
Download sequence
Identical sequences A0A0E9DM88 B0B9K2 B0BB81
gi|478451417|ref|YP_007714723.1| gi|478466752|ref|YP_007718284.1| gi|166154315|ref|YP_001654433.1| gi|478469461|ref|YP_007722741.1| gi|478453230|ref|YP_007717392.1| gi|482545452|ref|YP_007851370.1| gi|527325616|ref|YP_008351809.1| WP_009873551.1.100883 WP_009873551.1.101735 WP_009873551.1.11148 WP_009873551.1.11732 WP_009873551.1.17082 WP_009873551.1.18643 WP_009873551.1.25195 WP_009873551.1.27753 WP_009873551.1.27980 WP_009873551.1.38181 WP_009873551.1.38794 WP_009873551.1.40464 WP_009873551.1.40808 WP_009873551.1.42718 WP_009873551.1.45552 WP_009873551.1.48923 WP_009873551.1.49465 WP_009873551.1.51159 WP_009873551.1.53299 WP_009873551.1.5416 WP_009873551.1.58046 WP_009873551.1.58308 WP_009873551.1.5967 WP_009873551.1.60427 WP_009873551.1.61004 WP_009873551.1.62489 WP_009873551.1.64162 WP_009873551.1.71307 WP_009873551.1.79775 WP_009873551.1.83642 WP_009873551.1.85365 WP_009873551.1.87079 WP_009873551.1.95142 WP_009873551.1.97423 WP_009873551.1.99598 YP_001654433.1.27483 gi|478446924|ref|YP_007715612.1| gi|166155190|ref|YP_001653445.1| gi|478462256|ref|YP_007738077.1| gi|482546394|ref|YP_007852310.1| gi|478450517|ref|YP_007720959.1| gi|527319790|ref|YP_008345990.1| 471472.CTL0349 471473.CTLon_0345 gi|527327465|ref|YP_008353656.1| gi|478447815|ref|YP_007721849.1| gi|478452318|ref|YP_007720066.1| gi|478471252|ref|YP_007739855.1| gi|478449617|ref|YP_007719174.1| gi|478467652|ref|YP_007742525.1| gi|527328392|ref|YP_008354582.1| gi|478454123|ref|YP_007716502.1| gi|339625746|ref|YP_004717225.1| gi|478470361|ref|YP_007729002.1| gi|478463155|ref|YP_007738967.1| gi|527324692|ref|YP_008350886.1| gi|527317909|ref|YP_008344111.1| gi|527323557|ref|YP_008349753.1| gi|478464053|ref|YP_007740745.1| gi|478464953|ref|YP_007741635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]