SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452320|ref|YP_007720068.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452320|ref|YP_007720068.1|
Domain Number 1 Region: 399-574
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.25e-45
Family G proteins 0.00022
Further Details:      
 
Domain Number 2 Region: 680-803
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 2.22e-32
Family Initiation factor IF2/eIF5b, domain 3 0.002
Further Details:      
 
Domain Number 3 Region: 798-894
Classification Level Classification E-value
Superfamily Translation proteins 6.24e-30
Family Elongation factors 0.0000926
Further Details:      
 
Domain Number 4 Region: 574-656
Classification Level Classification E-value
Superfamily Translation proteins 5.41e-21
Family Elongation factors 0.0085
Further Details:      
 
Weak hits

Sequence:  gi|478452320|ref|YP_007720068.1|
Domain Number - Region: 320-355
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0769
Family N-terminal subdomain of bacterial translation initiation factor IF2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452320|ref|YP_007720068.1|
Sequence length 896
Comment translation initiation factor IF-2 [Chlamydia trachomatis L2b/Canada1]
Sequence
MEKAKLTKNLKLKIKNAQLTKAAGLDKLKQKLAQAGSSDTKNSPASKAQTKEKSSKKTAG
TPAPAPEVDLGATESTARRIRAKDRSSFAAEPTVTTALPGDASHLTLDAIPAIKAPEITS
VTQKEQTLRECTDTSSVQQEEKKESSEETSPETPERIEETPIIRTRTEPKSVVSIKPKFG
PTGKHINHLLAKTFKAPAKETKAASTEETTQQQPRQNDAASHNNKQQPSGTSSRPASSAP
SYRRESTSNNNNNAKRGSERDRSKRSDESVKAFTGRDRYGLNEGSSEEDKWRKKRVHKTK
KQAEEHVVQCPAHIKIALPITVKDLAAEMKLKASELIQKLFIHGMTYVVNDVLDSQTVVE
YIGLEFGCTIEIDSSAKEKLCLVENTVRDEVNATDPEKLIIRSPIVAFMGHVDHGKTTII
DALRQSNMAASEAGAITQHTGAFKCTTPVGEITVLDTPGHEAFSAMRARGAEVCDIVVLV
VAGDEGIKEQTIEAIEHAKGANITIVVAINKCDKPNFNVETVYRQLAELDLLPEAWGGSI
ATINTSAKTGEGLQDLLEMLALQAEVLELKADPSARARGLVIESELHKGLGAVATVLVQN
GTLHLGEALVFNDCYGKVKTMHDEHNQLLQSATPSTPVLITGLSAIPKAGDPFIVVKNEK
VAKEIISARLAGQQRSAALQKKRPNFDAVLQNKKTLKLIIKADVQGSIEALAHSILNIRS
EKVDVEILSSGVGDISESDIRLASASKATVIGFHTSVESHAEPLIKNLNVKVCLFDIIYH
AVDAIKEIMTGLLDPIAEEKNLGAAEIKATFKSSQLGTIYGCLVTEGTVVRNQKIRIIRD
KEVLWKGSLSSLKRLKEDVKEVKKGMECGILLDNYQQAQVGDILQCYEVIYHPQTL
Download sequence
Identical sequences A0A0E9AW85 B0B9K4 B0BB83
gi|166155192|ref|YP_001653447.1| gi|478450519|ref|YP_007720961.1| gi|478470363|ref|YP_007729004.1| gi|527324694|ref|YP_008350888.1| gi|478449619|ref|YP_007719176.1| gi|527325618|ref|YP_008351811.1| gi|478466754|ref|YP_007718286.1| gi|478467654|ref|YP_007742527.1| gi|482546396|ref|YP_007852312.1| gi|478453232|ref|YP_007717394.1| gi|527317911|ref|YP_008344113.1| gi|478471254|ref|YP_007739857.1| gi|478464955|ref|YP_007741637.1| gi|482545454|ref|YP_007851372.1| gi|478452320|ref|YP_007720068.1| gi|478446926|ref|YP_007715614.1| WP_009873552.1.100883 WP_009873552.1.101735 WP_009873552.1.11148 WP_009873552.1.11732 WP_009873552.1.17082 WP_009873552.1.18643 WP_009873552.1.25195 WP_009873552.1.27753 WP_009873552.1.27980 WP_009873552.1.38181 WP_009873552.1.38794 WP_009873552.1.40464 WP_009873552.1.40808 WP_009873552.1.42718 WP_009873552.1.45552 WP_009873552.1.48923 WP_009873552.1.49465 WP_009873552.1.53299 WP_009873552.1.5416 WP_009873552.1.58046 WP_009873552.1.58308 WP_009873552.1.5967 WP_009873552.1.60427 WP_009873552.1.61004 WP_009873552.1.62489 WP_009873552.1.64162 WP_009873552.1.71307 WP_009873552.1.79775 WP_009873552.1.83642 WP_009873552.1.85365 WP_009873552.1.87079 WP_009873552.1.95142 WP_009873552.1.97423 WP_009873552.1.99598 YP_001654435.1.27483 gi|478464055|ref|YP_007740747.1| gi|478469463|ref|YP_007722743.1| gi|166154317|ref|YP_001654435.1| gi|527319792|ref|YP_008345992.1| gi|478454125|ref|YP_007716504.1| gi|527328394|ref|YP_008354584.1| gi|527327467|ref|YP_008353658.1| gi|478447817|ref|YP_007721851.1| gi|478451419|ref|YP_007714725.1| gi|527323559|ref|YP_008349755.1| 471472.CTL0351 471473.CTLon_0347 gi|478462258|ref|YP_007738079.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]