SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452327|ref|YP_007720075.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452327|ref|YP_007720075.1|
Domain Number 1 Region: 5-286
Classification Level Classification E-value
Superfamily HAD-like 9.49e-31
Family Predicted hydrolases Cof 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452327|ref|YP_007720075.1|
Sequence length 298
Comment phosphoglycolate phosphatase [Chlamydia trachomatis L2b/Canada1]
Sequence
MSLQKLLVTDIDGTITHQSHLLHDRVVKALHQYYDSGWQLFFLTGRYFSYAYPLFQNFSV
PFLLGSQNGSSVWSSTDKEFIYFRSLSRDFLCVLEKYFEDLDLIACIESGASNRDVYFRK
GLGKTSQELKAILDAVYFPTPEAARLLVDVQGHLSEEFSYEDFAIAKFFGEREEVKKIMD
RFIQSPEVSSQVTMNYMRWPFDFKYAVLLLTLKDVSKGFAVDQVVQTFYKENKPFIMASG
DDVNDIDLLSRGDFKIVIQTAPEEMHGLADFLAPPAKDLGILSAWEAGELRYKQLVNP
Download sequence
Identical sequences A0A0E9E0Z4 A0A0H3MGQ5
gi|527325625|ref|YP_008351818.1| gi|478451426|ref|YP_007714732.1| gi|478470370|ref|YP_007729011.1| gi|478464062|ref|YP_007740754.1| gi|478464962|ref|YP_007741644.1| gi|166154324|ref|YP_001654442.1| gi|478446933|ref|YP_007715621.1| gi|339625755|ref|YP_004717234.1| gi|482546403|ref|YP_007852319.1| gi|478454132|ref|YP_007716511.1| gi|478449626|ref|YP_007719183.1| gi|527327474|ref|YP_008353665.1| gi|478463164|ref|YP_007738976.1| gi|527319799|ref|YP_008345999.1| gi|478462265|ref|YP_007738086.1| gi|478447824|ref|YP_007721858.1| gi|478469470|ref|YP_007722750.1| gi|482545461|ref|YP_007851379.1| gi|478450526|ref|YP_007720968.1| gi|478467661|ref|YP_007742534.1| gi|527323566|ref|YP_008349762.1| gi|478471261|ref|YP_007739864.1| gi|478453239|ref|YP_007717401.1| gi|166155199|ref|YP_001653454.1| gi|478452327|ref|YP_007720075.1| gi|478466761|ref|YP_007718293.1| 471472.CTL0358 471473.CTLon_0354 gi|527328401|ref|YP_008354591.1| WP_009873558.1.100883 WP_009873558.1.101735 WP_009873558.1.11148 WP_009873558.1.11732 WP_009873558.1.17082 WP_009873558.1.18643 WP_009873558.1.25195 WP_009873558.1.27753 WP_009873558.1.27980 WP_009873558.1.38181 WP_009873558.1.38794 WP_009873558.1.40464 WP_009873558.1.40808 WP_009873558.1.42718 WP_009873558.1.45552 WP_009873558.1.48923 WP_009873558.1.49465 WP_009873558.1.51159 WP_009873558.1.53299 WP_009873558.1.5416 WP_009873558.1.58308 WP_009873558.1.5967 WP_009873558.1.60427 WP_009873558.1.61004 WP_009873558.1.62489 WP_009873558.1.64162 WP_009873558.1.71307 WP_009873558.1.79775 WP_009873558.1.83642 WP_009873558.1.85365 WP_009873558.1.87079 WP_009873558.1.95142 WP_009873558.1.97423 WP_009873558.1.99598 YP_001654442.1.27483 gi|527324701|ref|YP_008350895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]