SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452330|ref|YP_007720078.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452330|ref|YP_007720078.1|
Domain Number 1 Region: 68-261
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.96e-52
Family Pseudouridine synthase RsuA/RluD 0.00013
Further Details:      
 
Weak hits

Sequence:  gi|478452330|ref|YP_007720078.1|
Domain Number - Region: 12-63
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00157
Family Ribosomal protein S4 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452330|ref|YP_007720078.1|
Sequence length 274
Comment 23S rRNA pseudouridylate synthase C [Chlamydia trachomatis L2b/Canada1]
Sequence
MQEFIGTADRHIRLSSFLRTSLPHLPKKTILESVRYHGCRVNGRIERFESYKLQPGDRVS
LQIIEHSSPQLLWEDEHLCIYNKPAKQTSEDLAHQLNVHLVHRLDRDTSGCILFAKHAKA
SSLITQLFKNREIDKRYIALVFGQPRQESGIITTYTAPCYRRTGAVLFGNTDQNSGKITI
TKWEILTRYPKYTLLLCRPVTGRTHQIRLHMKTIGHPIVGDVDYGNQEQPKNVVRTLLHA
ASLAFISPFSNEKIEISSLTPSQDPYPFYADFRP
Download sequence
Identical sequences A0A0E9E101 A0A0H3MBP3
gi|478447827|ref|YP_007721861.1| gi|478466764|ref|YP_007718296.1| gi|478470373|ref|YP_007729014.1| gi|527319802|ref|YP_008346002.1| gi|478471264|ref|YP_007739867.1| gi|166154327|ref|YP_001654445.1| gi|478453242|ref|YP_007717404.1| gi|478449629|ref|YP_007719186.1| gi|478454135|ref|YP_007716514.1| gi|527325628|ref|YP_008351821.1| gi|478450529|ref|YP_007720971.1| gi|478452330|ref|YP_007720078.1| gi|478446936|ref|YP_007715624.1| gi|339625758|ref|YP_004717237.1| gi|527324704|ref|YP_008350898.1| gi|166155202|ref|YP_001653457.1| gi|527328404|ref|YP_008354594.1| 471472.CTL0361 471473.CTLon_0357 gi|478464965|ref|YP_007741647.1| gi|478462268|ref|YP_007738089.1| gi|478451429|ref|YP_007714735.1| WP_009873561.1.100883 WP_009873561.1.101735 WP_009873561.1.11148 WP_009873561.1.11732 WP_009873561.1.17082 WP_009873561.1.18643 WP_009873561.1.25195 WP_009873561.1.27753 WP_009873561.1.27980 WP_009873561.1.38181 WP_009873561.1.38794 WP_009873561.1.40464 WP_009873561.1.40808 WP_009873561.1.42718 WP_009873561.1.45552 WP_009873561.1.48923 WP_009873561.1.49465 WP_009873561.1.51159 WP_009873561.1.53299 WP_009873561.1.5416 WP_009873561.1.58308 WP_009873561.1.5967 WP_009873561.1.60427 WP_009873561.1.61004 WP_009873561.1.62489 WP_009873561.1.64162 WP_009873561.1.71307 WP_009873561.1.79775 WP_009873561.1.83642 WP_009873561.1.85365 WP_009873561.1.87079 WP_009873561.1.95142 WP_009873561.1.97423 WP_009873561.1.99598 YP_001654445.1.27483 gi|527327477|ref|YP_008353668.1| gi|482545464|ref|YP_007851382.1| gi|478464065|ref|YP_007740757.1| gi|527323569|ref|YP_008349765.1| gi|478469473|ref|YP_007722753.1| gi|478463167|ref|YP_007738979.1| gi|482546406|ref|YP_007852322.1| gi|478467664|ref|YP_007742537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]