SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452345|ref|YP_007720093.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452345|ref|YP_007720093.1|
Domain Number 1 Region: 6-214
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.51e-60
Family D-ribulose-5-phosphate 3-epimerase 0.00000901
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452345|ref|YP_007720093.1|
Sequence length 228
Comment ribulose-phosphate 3-epimerase [Chlamydia trachomatis L2b/Canada1]
Sequence
MKKQGVLVAPSIMGADLACIGREARNIEESGADLIHIDVMDGHFVPNITFGPGVVAAINR
STELFLEVHAMIYTPFEFVEAFVKAGADRIIVHFEAAENIKEIISYIQKCGVQAGVAFSP
ETSIEFVTSFIPLCDVILLMSVHPGFCGQKFIPDTIERIQFVKQAIQVLGREGSCLIEVD
GGIDKESARACREAGADILVAASYFFEKDSINMKEKVLLLQGEEHGAK
Download sequence
Identical sequences A0A0E9D7L5 A0A0H3MBQ2
gi|527319818|ref|YP_008346018.1| gi|478450545|ref|YP_007720987.1| gi|237802551|ref|YP_002887745.1| gi|478453258|ref|YP_007717420.1| gi|478448737|ref|YP_007723660.1| gi|478470389|ref|YP_007729030.1| gi|527324721|ref|YP_008350915.1| gi|478452345|ref|YP_007720093.1| gi|527323585|ref|YP_008349781.1| gi|527328420|ref|YP_008354610.1| gi|527327494|ref|YP_008353685.1| WP_009873576.1.100644 WP_009873576.1.100883 WP_009873576.1.101362 WP_009873576.1.101735 WP_009873576.1.102133 WP_009873576.1.11148 WP_009873576.1.11732 WP_009873576.1.13674 WP_009873576.1.17082 WP_009873576.1.17422 WP_009873576.1.18643 WP_009873576.1.25195 WP_009873576.1.27753 WP_009873576.1.27980 WP_009873576.1.30792 WP_009873576.1.31128 WP_009873576.1.34934 WP_009873576.1.38181 WP_009873576.1.38504 WP_009873576.1.38794 WP_009873576.1.40464 WP_009873576.1.40808 WP_009873576.1.4264 WP_009873576.1.42718 WP_009873576.1.43504 WP_009873576.1.45552 WP_009873576.1.48923 WP_009873576.1.49465 WP_009873576.1.53299 WP_009873576.1.5416 WP_009873576.1.55117 WP_009873576.1.58308 WP_009873576.1.5967 WP_009873576.1.60427 WP_009873576.1.60937 WP_009873576.1.61004 WP_009873576.1.6151 WP_009873576.1.61683 WP_009873576.1.62239 WP_009873576.1.62489 WP_009873576.1.62968 WP_009873576.1.64162 WP_009873576.1.65182 WP_009873576.1.67250 WP_009873576.1.69355 WP_009873576.1.71307 WP_009873576.1.71619 WP_009873576.1.71686 WP_009873576.1.72164 WP_009873576.1.74323 WP_009873576.1.75470 WP_009873576.1.77651 WP_009873576.1.79775 WP_009873576.1.83525 WP_009873576.1.83642 WP_009873576.1.85365 WP_009873576.1.86066 WP_009873576.1.87079 WP_009873576.1.92427 WP_009873576.1.93216 WP_009873576.1.9343 WP_009873576.1.93600 WP_009873576.1.95142 WP_009873576.1.97423 WP_009873576.1.97602 WP_009873576.1.99598 YP_001654460.1.27483 gi|527325644|ref|YP_008351837.1| gi|478467680|ref|YP_007742553.1| gi|385246018|ref|YP_005814840.1| gi|166155217|ref|YP_001653472.1| gi|478459573|ref|YP_007733641.1| gi|482546422|ref|YP_007852338.1| gi|478449645|ref|YP_007719202.1| gi|478462284|ref|YP_007738105.1| gi|339625775|ref|YP_004717254.1| gi|478458665|ref|YP_007731849.1| gi|482545480|ref|YP_007851398.1| gi|478471280|ref|YP_007739883.1| gi|385239632|ref|YP_005807474.1| gi|478457770|ref|YP_007730955.1| gi|478456858|ref|YP_007725451.1| gi|478464981|ref|YP_007741663.1| gi|385242408|ref|YP_005810247.1| gi|478447843|ref|YP_007721877.1| gi|166154342|ref|YP_001654460.1| gi|478466780|ref|YP_007718312.1| gi|237804468|ref|YP_002888622.1| gi|478455051|ref|YP_007727241.1| gi|478446952|ref|YP_007715640.1| 471472.CTL0376 471473.CTLon_0372 580049.JALI_1201 672161.CTB_1201 gi|385240552|ref|YP_005808393.1| gi|478469489|ref|YP_007722769.1| gi|478454151|ref|YP_007716530.1| gi|478451445|ref|YP_007714751.1| gi|478464081|ref|YP_007740773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]