SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452346|ref|YP_007720094.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452346|ref|YP_007720094.1|
Domain Number 1 Region: 129-185
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000394
Family Cold shock DNA-binding domain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 66-126
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000244
Family Cold shock DNA-binding domain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 1-62
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000229
Family eIF5a N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452346|ref|YP_007720094.1|
Sequence length 185
Comment elongation factor P [Chlamydia trachomatis L2b/Canada1]
Sequence
MVLSSQLSVGMFISTKDGLYKVVSVSKVSGNKGDTFIKVSLQAAGSDVIVERNFKAGQEV
KEAQFEPRNLEYLYLEEDKYLFLDLGNYDKIYIPKEIMKDNAMFLKAGVTVFALVHEGTV
FSMELPHFLELMVAKTDFPGDSLSLSGGAKKALLETGVEVLVPPFVEIGDVIKVDTRTCE
YIQRV
Download sequence
Identical sequences A0A0E9E2V6 A0A0H3MBF8
gi|478428256|ref|YP_007540696.1| gi|527319819|ref|YP_008346019.1| gi|385241485|ref|YP_005809325.1| gi|389859568|ref|YP_006361808.1| WP_009872392.1.100466 WP_009872392.1.100883 WP_009872392.1.101735 WP_009872392.1.11148 WP_009872392.1.11717 WP_009872392.1.11732 WP_009872392.1.13766 WP_009872392.1.13837 WP_009872392.1.1409 WP_009872392.1.14786 WP_009872392.1.15381 WP_009872392.1.17082 WP_009872392.1.18643 WP_009872392.1.1923 WP_009872392.1.19304 WP_009872392.1.20022 WP_009872392.1.22210 WP_009872392.1.25195 WP_009872392.1.25246 WP_009872392.1.27753 WP_009872392.1.27980 WP_009872392.1.28239 WP_009872392.1.29171 WP_009872392.1.31373 WP_009872392.1.32156 WP_009872392.1.32801 WP_009872392.1.32856 WP_009872392.1.35043 WP_009872392.1.36244 WP_009872392.1.36518 WP_009872392.1.3661 WP_009872392.1.37417 WP_009872392.1.37673 WP_009872392.1.37956 WP_009872392.1.38181 WP_009872392.1.38794 WP_009872392.1.38813 WP_009872392.1.39258 WP_009872392.1.40272 WP_009872392.1.40464 WP_009872392.1.40808 WP_009872392.1.4187 WP_009872392.1.42718 WP_009872392.1.44223 WP_009872392.1.45552 WP_009872392.1.48551 WP_009872392.1.48923 WP_009872392.1.4939 WP_009872392.1.49465 WP_009872392.1.51159 WP_009872392.1.51530 WP_009872392.1.53299 WP_009872392.1.5416 WP_009872392.1.57520 WP_009872392.1.57533 WP_009872392.1.58046 WP_009872392.1.58308 WP_009872392.1.5967 WP_009872392.1.60427 WP_009872392.1.61004 WP_009872392.1.62489 WP_009872392.1.62510 WP_009872392.1.64162 WP_009872392.1.66489 WP_009872392.1.67104 WP_009872392.1.69519 WP_009872392.1.69991 WP_009872392.1.71307 WP_009872392.1.74635 WP_009872392.1.77153 WP_009872392.1.78375 WP_009872392.1.79775 WP_009872392.1.83642 WP_009872392.1.85256 WP_009872392.1.85365 WP_009872392.1.87079 WP_009872392.1.87298 WP_009872392.1.87666 WP_009872392.1.88177 WP_009872392.1.88937 WP_009872392.1.9107 WP_009872392.1.95142 WP_009872392.1.96955 WP_009872392.1.97423 WP_009872392.1.99598 YP_001654461.1.27483 gi|339625776|ref|YP_004717255.1| gi|527321688|ref|YP_008347886.1| gi|478451446|ref|YP_007714752.1| gi|527323586|ref|YP_008349782.1| gi|478455962|ref|YP_007726345.1| gi|478462285|ref|YP_007738106.1| gi|527317937|ref|YP_008344139.1| gi|389857818|ref|YP_006360060.1| gi|478461372|ref|YP_007736322.1| gi|478469490|ref|YP_007722770.1| gi|389858691|ref|YP_006360932.1| gi|478450546|ref|YP_007720988.1| gi|478452346|ref|YP_007720094.1| gi|478472181|ref|YP_007732748.1| gi|478470390|ref|YP_007729031.1| 471472.CTL0377 471473.CTLon_0373 gi|478454152|ref|YP_007716531.1| gi|527324722|ref|YP_008350916.1| gi|166155218|ref|YP_001653473.1| gi|478471281|ref|YP_007739884.1| gi|166154343|ref|YP_001654461.1| gi|478446953|ref|YP_007715641.1| gi|478453259|ref|YP_007717421.1| gi|385245094|ref|YP_005813917.1| gi|478466781|ref|YP_007718313.1| gi|478449646|ref|YP_007719203.1| gi|527325645|ref|YP_008351838.1| gi|386262476|ref|YP_005815755.1| gi|527328421|ref|YP_008354611.1| gi|478473085|ref|YP_007734533.1| gi|478447844|ref|YP_007721878.1| gi|482546423|ref|YP_007852339.1| gi|478464982|ref|YP_007741664.1| gi|478473988|ref|YP_007730064.1| gi|471328296|ref|YP_007539821.1| gi|527326571|ref|YP_008352763.1| gi|527327495|ref|YP_008353686.1| gi|527318860|ref|YP_008345061.1| gi|478464082|ref|YP_007740774.1| gi|527320735|ref|YP_008346934.1| gi|478463184|ref|YP_007738996.1| gi|478467681|ref|YP_007742554.1| gi|482545481|ref|YP_007851399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]