SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452391|ref|YP_007720139.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452391|ref|YP_007720139.1|
Domain Number 1 Region: 1-234
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.79e-50
Family Tryptophan biosynthesis enzymes 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452391|ref|YP_007720139.1|
Sequence length 253
Comment tryptophan synthase subunit alpha [Chlamydia trachomatis L2b/Canada1]
Sequence
MSKLTQVFKQTKPCIGYLTAGDGGTSYTIEAAKALIQGGVDILELGFPFSDPVADNPEIQ
VSHDRALAENLTSETLLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGV
CVIDLPAPLSHGEKSPFFEDLLAVGLDPILLISAGTTPERMSLIQEYARGFLYYIPYEAT
RDSEVGIKEEFRKVREHFDLPIVDRRDICDKKEAAHVLNYSDGFIVKTAFVHQTTMDSSV
ETLTALAQTVIPG
Download sequence
Identical sequences A0A0H3MKP4 F9YDM4 Q8KID2
gi|527323631|ref|YP_008349827.1| gi|166155257|ref|YP_001653512.1| gi|482545530|ref|YP_007851448.1| gi|478471326|ref|YP_007739929.1| gi|166154382|ref|YP_001654500.1| gi|478451491|ref|YP_007714797.1| gi|478446999|ref|YP_007715687.1| gi|478462330|ref|YP_007738151.1| gi|527319864|ref|YP_008346064.1| gi|478470435|ref|YP_007729076.1| WP_009873613.1.100883 WP_009873613.1.101735 WP_009873613.1.11148 WP_009873613.1.11732 WP_009873613.1.17082 WP_009873613.1.18643 WP_009873613.1.25195 WP_009873613.1.27753 WP_009873613.1.27980 WP_009873613.1.38181 WP_009873613.1.40464 WP_009873613.1.40808 WP_009873613.1.42718 WP_009873613.1.45552 WP_009873613.1.48923 WP_009873613.1.49465 WP_009873613.1.51159 WP_009873613.1.53299 WP_009873613.1.5416 WP_009873613.1.58046 WP_009873613.1.58308 WP_009873613.1.5967 WP_009873613.1.60427 WP_009873613.1.61004 WP_009873613.1.62489 WP_009873613.1.64162 WP_009873613.1.71307 WP_009873613.1.79775 WP_009873613.1.83642 WP_009873613.1.85365 WP_009873613.1.87079 WP_009873613.1.99598 YP_001654500.1.27483 gi|478469536|ref|YP_007722816.1| gi|527317983|ref|YP_008344185.1| gi|478450592|ref|YP_007721034.1| gi|478454197|ref|YP_007716576.1| 471472.CTL0424 471473.CTLon_0418 gi|478466826|ref|YP_007718358.1| gi|527328466|ref|YP_008354656.1| gi|482546472|ref|YP_007852388.1| gi|527325690|ref|YP_008351883.1| gi|478467727|ref|YP_007742600.1| gi|478463229|ref|YP_007739041.1| gi|478453305|ref|YP_007717467.1| gi|339625827|ref|YP_004717306.1| gi|527327540|ref|YP_008353731.1| gi|478464127|ref|YP_007740819.1| gi|478447891|ref|YP_007721925.1| gi|478452391|ref|YP_007720139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]