SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452401|ref|YP_007720149.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452401|ref|YP_007720149.1|
Domain Number 1 Region: 9-247
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9.24e-53
Family Cytidylytransferase 0.00000921
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452401|ref|YP_007720149.1|
Sequence length 254
Comment 3-deoxy-manno-octulosonate cytidylyltransferase [Chlamydia trachomatis L2b/Canada1]
Sequence
MFAFLTSKKVGILPSRWGSSRFPGKPLAKILGKTLVQRSYENALSSQSLDCVVVATDDQR
IFDHVVEFGGLCVMTSTSCANGTERVEEVVSRHFPQAEIVVNIQGDEPCLSPTVIDGLVS
TLENNPAADMVTPVTETTDPEAILTDHKVKCVFDKNGKALYFSRSAIPHNFKHPTPIYLH
IGVYAFRKAFLSEYVKIPPSSLSLAEDLEQLRVLETGRSIYVHVVQNATGPSVDYPEDIT
KVEQYLLCLSKASF
Download sequence
Identical sequences A0A0E9DQ42 B0B9T2 B0BBG2
gi|478469546|ref|YP_007722826.1| gi|478451501|ref|YP_007714807.1| 471472.CTL0434 471473.CTLon_0429 gi|478454207|ref|YP_007716586.1| gi|527323642|ref|YP_008349838.1| gi|482545540|ref|YP_007851458.1| gi|478463239|ref|YP_007739051.1| gi|478471336|ref|YP_007739939.1| gi|478462340|ref|YP_007738161.1| gi|527327551|ref|YP_008353742.1| gi|478465037|ref|YP_007741719.1| gi|478453315|ref|YP_007717477.1| WP_009873621.1.100883 WP_009873621.1.101735 WP_009873621.1.11148 WP_009873621.1.11732 WP_009873621.1.17082 WP_009873621.1.18643 WP_009873621.1.25195 WP_009873621.1.27753 WP_009873621.1.27980 WP_009873621.1.38181 WP_009873621.1.38794 WP_009873621.1.40464 WP_009873621.1.40808 WP_009873621.1.42718 WP_009873621.1.45552 WP_009873621.1.48923 WP_009873621.1.49465 WP_009873621.1.51159 WP_009873621.1.53299 WP_009873621.1.5416 WP_009873621.1.58046 WP_009873621.1.58308 WP_009873621.1.5967 WP_009873621.1.60427 WP_009873621.1.61004 WP_009873621.1.62489 WP_009873621.1.64162 WP_009873621.1.71307 WP_009873621.1.79775 WP_009873621.1.83642 WP_009873621.1.85365 WP_009873621.1.87079 WP_009873621.1.97423 WP_009873621.1.99598 YP_001654510.1.27483 gi|166154392|ref|YP_001654510.1| gi|478464137|ref|YP_007740829.1| gi|166155267|ref|YP_001653522.1| gi|478450602|ref|YP_007721044.1| gi|527319875|ref|YP_008346075.1| gi|339625837|ref|YP_004717316.1| gi|478447009|ref|YP_007715697.1| gi|478467737|ref|YP_007742610.1| gi|478452401|ref|YP_007720149.1| gi|482546483|ref|YP_007852399.1| gi|527328476|ref|YP_008354666.1| gi|478466836|ref|YP_007718368.1| gi|478470445|ref|YP_007729086.1| gi|478449701|ref|YP_007719258.1| gi|478447901|ref|YP_007721935.1| gi|527317993|ref|YP_008344195.1| gi|527325701|ref|YP_008351894.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]