SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452408|ref|YP_007720156.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452408|ref|YP_007720156.1|
Domain Number 1 Region: 31-487
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 2.88e-169
Family Type II DNA topoisomerase 0.000000000743
Further Details:      
 
Domain Number 2 Region: 500-820
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 2.22e-93
Family GyrA/ParC C-terminal domain-like 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452408|ref|YP_007720156.1|
Sequence length 836
Comment DNA gyrase subunit A [Chlamydia trachomatis L2b/Canada1]
Sequence
MLNKEEIIVPKNLEEEMKESYLRYSMSVIISRALPDARDGLKPSQRRILYAMKQLNLTPG
VKHRKCAKICGDTSGDYHPHGESVIYPTLVRMAQDWAMRYPLVDGQGNFGSIDGDPAAAM
RYTEARLTHSAIFLLEDLDKDTVDMVPNYDETKYEPVVFPSKFPNLLCNGSSGIAVGMAT
NIPPHNLGELIEATLLVLANSQTSIEDILEVMPGPDFPTGGIICGTEGIRSTYYTGRGKL
RLRARMHVEENSDKQRENIILTEMPYNVNKSRLIEQIAELINEKTLTGISDVRDESDKDG
IRVVLELKKGESSEVVINRLYKFTDVQVTFGANMLALDKNLPRTMNIHRMISAWIRHRMD
VIRRRTRYELNKAEARAHILEGFLKALSCMDEVVKTIRESSNKEHAKQQLVELFSFSEAQ
ALAILELRLYQLTGLEADKVQKEYSELLEKITYYRKVLAEEELVKDIIREELQELHKVHK
TPRRTKIEMDTGDVRDIEDIISDESVIITISGDDYVKRMPVKVFREQKRGGQGVTGFDMK
KGSDFLKAVYSASTKDYLLIFTNFGQCYWLKVWQLPEGERRAKGKPIINFLEGIRPGEQV
AAVLNVKRFEQGEYLFLATKKGVVKKVSLDAFGSPRKKGIRALEIDDGDELIAARHIAND
EEKVMLFTRLGMAVRFPHDKVRPMGRAARGVRGVSLKNEQDFVVSCQVVTEDQSVLVVCD
NGFGKRSLVCDFRETNRGSVGVRSIVINQRNGDVLGAISVTDCDSILLMSAQGQAIRINM
QDVRVMGRATQGVRLVNLREGDTLVAMEKLSINTESVETEENLAASVQSGQDTIEE
Download sequence
Identical sequences A0A0H3MGV6 F9YDP1 H6V6S9
gi|478470452|ref|YP_007729093.1| gi|478467744|ref|YP_007742617.1| gi|478469553|ref|YP_007722833.1| gi|478450609|ref|YP_007721051.1| gi|478453322|ref|YP_007717484.1| gi|478449708|ref|YP_007719265.1| gi|478451508|ref|YP_007714814.1| gi|166155274|ref|YP_001653529.1| gi|478463246|ref|YP_007739058.1| gi|478466843|ref|YP_007718375.1| gi|166154399|ref|YP_001654517.1| gi|478454214|ref|YP_007716593.1| gi|478452408|ref|YP_007720156.1| gi|482546490|ref|YP_007852406.1| gi|478471343|ref|YP_007739946.1| gi|478447016|ref|YP_007715704.1| gi|478464144|ref|YP_007740836.1| WP_009873626.1.100883 WP_009873626.1.101735 WP_009873626.1.11732 WP_009873626.1.17082 WP_009873626.1.18643 WP_009873626.1.25195 WP_009873626.1.27753 WP_009873626.1.38181 WP_009873626.1.38794 WP_009873626.1.40464 WP_009873626.1.40808 WP_009873626.1.42718 WP_009873626.1.45552 WP_009873626.1.48923 WP_009873626.1.49465 WP_009873626.1.51159 WP_009873626.1.5416 WP_009873626.1.58308 WP_009873626.1.5967 WP_009873626.1.62489 WP_009873626.1.64162 WP_009873626.1.71307 WP_009873626.1.79775 WP_009873626.1.83642 WP_009873626.1.85365 WP_009873626.1.97423 WP_009873626.1.99598 YP_001654517.1.27483 gi|478465044|ref|YP_007741726.1| 471472.CTL0441 471473.CTLon_0436 gi|339625844|ref|YP_004717323.1| gi|482545547|ref|YP_007851465.1| gi|478462347|ref|YP_007738168.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]