SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452423|ref|YP_007720171.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|478452423|ref|YP_007720171.1|
Domain Number - Region: 13-159
Classification Level Classification E-value
Superfamily ARM repeat 0.000192
Family HEAT repeat 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452423|ref|YP_007720171.1|
Sequence length 249
Comment hypothetical protein L2BCAN1_00206 [Chlamydia trachomatis L2b/Canada1]
Sequence
MEISHILEDLVYDNGVLPREAIEAAIVKHHQITPYLLKILEEAIDHVSDIIDDDCYQGHL
YAMYLLAQFRETRALPLIIKLFSFEQDIPHAIAGDVLTEDLSRILASVCDDVALIQELIE
TPHVNPYVQAAAISSLVALVGVHKLSRETAIRYFGELLNYRLEKKPSFAWDSLVASICAL
YPKELFYPISKAFSAGLIDTSFISMEDVETIIHEESIDSCLKEVFSSTDLINDTLEEMEK
WLERFPFES
Download sequence
Identical sequences A0A0E9AV58 A0A0H3MKR8
gi|527320810|ref|YP_008347009.1| gi|527318935|ref|YP_008345136.1| gi|166154413|ref|YP_001654531.1| gi|478470466|ref|YP_007729107.1| gi|478465058|ref|YP_007741740.1| gi|478467758|ref|YP_007742631.1| gi|478453336|ref|YP_007717498.1| gi|527325722|ref|YP_008351915.1| gi|478450623|ref|YP_007721065.1| gi|478452423|ref|YP_007720171.1| gi|478447030|ref|YP_007715718.1| gi|527321761|ref|YP_008347959.1| gi|478462361|ref|YP_007738182.1| gi|527326644|ref|YP_008352836.1| gi|478449722|ref|YP_007719279.1| gi|478469567|ref|YP_007722847.1| gi|527318014|ref|YP_008344216.1| gi|478466857|ref|YP_007718389.1| gi|527319896|ref|YP_008346096.1| gi|166155288|ref|YP_001653543.1| gi|478447922|ref|YP_007721956.1| gi|527324798|ref|YP_008350992.1| gi|339625859|ref|YP_004717338.1| gi|478471357|ref|YP_007739960.1| 471472.CTL0455 471473.CTLon_0450 WP_009872458.1.100883 WP_009872458.1.101735 WP_009872458.1.11148 WP_009872458.1.11732 WP_009872458.1.13766 WP_009872458.1.17082 WP_009872458.1.18643 WP_009872458.1.22210 WP_009872458.1.25195 WP_009872458.1.27753 WP_009872458.1.27980 WP_009872458.1.32801 WP_009872458.1.38181 WP_009872458.1.38794 WP_009872458.1.39258 WP_009872458.1.40464 WP_009872458.1.40808 WP_009872458.1.42718 WP_009872458.1.45552 WP_009872458.1.49465 WP_009872458.1.51159 WP_009872458.1.53299 WP_009872458.1.5416 WP_009872458.1.58046 WP_009872458.1.58308 WP_009872458.1.5967 WP_009872458.1.60427 WP_009872458.1.61004 WP_009872458.1.62489 WP_009872458.1.62510 WP_009872458.1.64162 WP_009872458.1.67104 WP_009872458.1.71307 WP_009872458.1.78375 WP_009872458.1.79775 WP_009872458.1.83642 WP_009872458.1.85365 WP_009872458.1.87079 WP_009872458.1.95142 WP_009872458.1.97423 WP_009872458.1.99598 YP_001654531.1.27483 gi|478463260|ref|YP_007739072.1| gi|478454228|ref|YP_007716607.1| gi|478451522|ref|YP_007714828.1| gi|527327572|ref|YP_008353763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]