SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452425|ref|YP_007720173.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452425|ref|YP_007720173.1|
Domain Number 1 Region: 20-520
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.05e-139
Family Phosphofructokinase 0.000000005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452425|ref|YP_007720173.1|
Sequence length 553
Comment diphosphate--fructose-6-phosphate 1-phosphotransferase [Chlamydia trachomatis L2b/Canada1]
Sequence
MSSNKHASLCQKTPSLCRELQKAPALLLTEDIRFKALLNERIDSVAELFPCTYNSPYYKF
ISKSDLSAETFPLKVGVMLSGGPAPGGHNVILGLLHSIKKLHPDSQLLGFIRNGEGLLNN
NTVEITDEFIEEFRNSGGFNCIGTGRTNIITEENKARCLQTANELDLDGLVIIGGDGSNT
ATAILAEYFAKHQAKTVLVGVPKTIDGDLQHLFLDLTFGFDTATKFYSSIISNISRDALS
CKGHYHFIKLMGRSSSHITLECALQTHPNIALIGEEIAEKSISLETLIHDICEIIADRAA
MGKYHGVILIPEGVIEFIPEIQSLVKEIESIPEQENLYQALSLSSQQLLCQFPEDICHQL
LYNRDAHGNVYVSKISVDKLLIHLVRQHLETHFRQVPFNAISHFLGYEGRSGTPTHFDNV
YSYNLGYGAGVLVFNRCNGYLSTIEGLTSPIEKWRLRALPIVRMLTTKQGKDSKHYPLIK
KRLVDIASPVFNKFSLYRKIWALEDSYRFVGPLQIHSPEDAHSDDFPPLILFLNHNEWQK
RCSICLEIPDQDY
Download sequence
Identical sequences A0A0E9B0X3 A0A0H3MBP7
gi|166155290|ref|YP_001653545.1| gi|527319898|ref|YP_008346098.1| gi|478462363|ref|YP_007738184.1| gi|527324800|ref|YP_008350994.1| gi|478447924|ref|YP_007721958.1| WP_009873636.1.100883 WP_009873636.1.101735 WP_009873636.1.11148 WP_009873636.1.11732 WP_009873636.1.17082 WP_009873636.1.18643 WP_009873636.1.22210 WP_009873636.1.25195 WP_009873636.1.27753 WP_009873636.1.27980 WP_009873636.1.32801 WP_009873636.1.38181 WP_009873636.1.38794 WP_009873636.1.40464 WP_009873636.1.40808 WP_009873636.1.42718 WP_009873636.1.45552 WP_009873636.1.48923 WP_009873636.1.49465 WP_009873636.1.51159 WP_009873636.1.53299 WP_009873636.1.5416 WP_009873636.1.58046 WP_009873636.1.58308 WP_009873636.1.5967 WP_009873636.1.60427 WP_009873636.1.61004 WP_009873636.1.62489 WP_009873636.1.64162 WP_009873636.1.71307 WP_009873636.1.79775 WP_009873636.1.83642 WP_009873636.1.85365 WP_009873636.1.87079 WP_009873636.1.95142 WP_009873636.1.97423 WP_009873636.1.99598 YP_001654533.1.27483 gi|478449724|ref|YP_007719281.1| gi|478471359|ref|YP_007739962.1| gi|478454230|ref|YP_007716609.1| gi|478463262|ref|YP_007739074.1| gi|482545563|ref|YP_007851481.1| gi|478452425|ref|YP_007720173.1| gi|527325724|ref|YP_008351917.1| 471472.CTL0457 471473.CTLon_0452 gi|478464160|ref|YP_007740852.1| gi|339625861|ref|YP_004717340.1| gi|478466859|ref|YP_007718391.1| gi|478453338|ref|YP_007717500.1| gi|166154415|ref|YP_001654533.1| gi|482546506|ref|YP_007852422.1| gi|527326646|ref|YP_008352838.1| gi|527321763|ref|YP_008347961.1| gi|478467760|ref|YP_007742633.1| gi|478469569|ref|YP_007722849.1| gi|478470468|ref|YP_007729109.1| gi|527327574|ref|YP_008353765.1| gi|478447032|ref|YP_007715720.1| gi|527328499|ref|YP_008354689.1| gi|478450625|ref|YP_007721067.1| gi|527318016|ref|YP_008344218.1| gi|527323665|ref|YP_008349861.1| gi|478451524|ref|YP_007714830.1| gi|478465060|ref|YP_007741742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]