SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452427|ref|YP_007720175.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452427|ref|YP_007720175.1|
Domain Number 1 Region: 14-536
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.31e-136
Family Phosphofructokinase 0.00000000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452427|ref|YP_007720175.1|
Sequence length 548
Comment diphosphate--fructose-6-phosphate 1-phosphotransferase [Chlamydia trachomatis L2b/Canada1]
Sequence
MELLSVNKSYFELQRLHYRPDTLSLLNSLCSMHIQEKPSSEPASDLLAKHIPHLCALPDL
TLQKDAPSSSEPLRIGVLLSGGQAPGGHNVVIGLFEGLRAFNKETKLFGFIKGPLGLIRG
LYKDLDISVIYDYYNAGGFDMLSSSREKIKTKEQKSAILATVKKMKLHGLLIVGGDNSNT
DTAMLAEYFIEHNCPTAVIGVPKTIDGDLKNAWIETPLGFHTSCRTYSEMIGNLEKDVLS
TRKYHHFVKLMGEQASHSTLECGLQTLPNITLIGEEVAVQHASLQSLSLSIAQGLIERFH
RGKDYSTILIPEGLIKQIPDTKRLIQELNTLIAEEQFSVHNLDQQLSPMAIETFSSLPEN
IRDQLLLDRDSYGNIRVSKIAIEELLASLVSKEISKLEPTMSFSPVTHFLGYESRASFPS
NFDSNYGLALGIAASLFLVRGKTGYMVTIGNLAETYTEWTIAATPLYKMMHLEKRFNQET
PVIKTDSVSPDAPMAKYLHKMKEICLLEDSYRFPGPLQYFEEQALVDQRPLTLLWEKGKL
SENNATKF
Download sequence
Identical sequences A0A0E9AUU8 A0A0H3MD63
gi|527324802|ref|YP_008350996.1| gi|527326648|ref|YP_008352840.1| gi|478470470|ref|YP_007729111.1| gi|527325726|ref|YP_008351919.1| gi|478467762|ref|YP_007742635.1| gi|527327576|ref|YP_008353767.1| gi|478462365|ref|YP_007738186.1| gi|478447926|ref|YP_007721960.1| gi|482545565|ref|YP_007851483.1| gi|478465062|ref|YP_007741744.1| gi|478450627|ref|YP_007721069.1| gi|527321765|ref|YP_008347963.1| gi|527319900|ref|YP_008346100.1| gi|527323667|ref|YP_008349863.1| gi|478454232|ref|YP_007716611.1| gi|478447034|ref|YP_007715722.1| gi|527318018|ref|YP_008344220.1| gi|482546508|ref|YP_007852424.1| gi|478471361|ref|YP_007739964.1| gi|478453340|ref|YP_007717502.1| gi|478466861|ref|YP_007718393.1| gi|478464162|ref|YP_007740854.1| WP_009873638.1.100883 WP_009873638.1.101735 WP_009873638.1.11148 WP_009873638.1.11732 WP_009873638.1.17082 WP_009873638.1.18643 WP_009873638.1.22210 WP_009873638.1.25195 WP_009873638.1.27753 WP_009873638.1.27980 WP_009873638.1.32801 WP_009873638.1.38181 WP_009873638.1.38794 WP_009873638.1.40464 WP_009873638.1.40808 WP_009873638.1.42718 WP_009873638.1.45552 WP_009873638.1.48923 WP_009873638.1.49465 WP_009873638.1.51159 WP_009873638.1.53299 WP_009873638.1.5416 WP_009873638.1.58046 WP_009873638.1.58308 WP_009873638.1.5967 WP_009873638.1.60427 WP_009873638.1.62489 WP_009873638.1.64162 WP_009873638.1.71307 WP_009873638.1.79775 WP_009873638.1.83642 WP_009873638.1.85365 WP_009873638.1.87079 WP_009873638.1.95142 WP_009873638.1.97423 WP_009873638.1.99598 YP_001654535.1.27483 471472.CTL0459 471473.CTLon_0454 gi|478463264|ref|YP_007739076.1| gi|478469571|ref|YP_007722851.1| gi|166155292|ref|YP_001653547.1| gi|166154417|ref|YP_001654535.1| gi|478452427|ref|YP_007720175.1| gi|478451526|ref|YP_007714832.1| gi|478449726|ref|YP_007719283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]