SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452454|ref|YP_007720202.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452454|ref|YP_007720202.1|
Domain Number 1 Region: 586-745,779-845
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000378
Family PBS lyase HEAT-like repeat 0.069
Further Details:      
 
Domain Number 2 Region: 25-422
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000000034
Family LacY-like proton/sugar symporter 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452454|ref|YP_007720202.1|
Sequence length 928
Comment hypothetical protein L2BCAN1_00241 [Chlamydia trachomatis L2b/Canada1]
Sequence
MLLFCKGSGSLRALRFLLSLRRGEEKRALLFLLLGLIWSVACYGSLALGESLFLEEIGAE
KLPFAYLGASFFLCFISCLILYNLSRKRVSPKALFLSFISCVLICNLYLFWHLAIHKGVS
GTPTFLYRILIWGLTILCYANFWGFIDQFFNIQDAKRHFCIFNAITFCGDFLGARIVNQI
QYLGAELILLAFIVVITFIFPLVHYISSSLKELSEDHDLFLDTGYPPSTKQTLKLCLKDK
YTFYLVSFYFLMQLLVVFTEFNYLKIFDAQFGNAETCELTENFTKYSSWISLGNMFFALF
AYSRVITRFGINNIILFAPICFFSLFCCWSIKTSVFIATMGMIAREGLAYALDDNNLQLL
IYGIPNKIRNQVRIAIESFVEPAGMFICALLCLFIPHQYVLCIIISAVCILLAILLRTHY
SKAILRNLSLESIHRRRSIREWFADMNDTEKRQAEILLLTHLKNPQERNQMFAFQHLLNL
KNRAVLPNLLLHMNKLGLSGKLKTLNMLKNSVWAKDFLTLELLKRWSSLPQHPTIAAALH
LYFVEHDLLHVSDIADDLYDQSGDRLFTAVLIVRKHKPGGEYQALAEKHLSEILESEDPE
LIIKGLSILALERSPSNFPIILPFLTHPNEQVFLQACLSLETCADKQYAQYGRTVLNTLK
KTKDTQAAQALLNTLAALLDASLVYEFVLASVQLKNVLRKLAETILASLPKECIPILIEM
VADHSLHNSCRIMAAKALSHIDSRQLKRLALKILKSKAAKALFYDYHKNFIQKRYPRYDL
HLLIESLEANYQAEVNFMLAFLAIVGSSDYADVLIRSLTGKNLKARAQALESLEKDCENH
LFTLVTPFVYRDKHTSDEKYYMKKGVEPLAIEELLNRLEQTPFLFSKLIAQQLKEELSLC
DAEFSSALQSFAKKQKTSILSREYITSS
Download sequence
Identical sequences A0A0E9DRT3 A0A0H3MBY7
gi|527318967|ref|YP_008345168.1| gi|478447953|ref|YP_007721987.1| gi|478451554|ref|YP_007714860.1| gi|478449753|ref|YP_007719310.1| gi|478453367|ref|YP_007717529.1| gi|478447061|ref|YP_007715749.1| gi|482545593|ref|YP_007851511.1| gi|339625891|ref|YP_004717370.1| gi|478465089|ref|YP_007741771.1| gi|478466888|ref|YP_007718420.1| gi|478462392|ref|YP_007738213.1| gi|478469598|ref|YP_007722878.1| gi|478463291|ref|YP_007739103.1| gi|478467789|ref|YP_007742662.1| gi|478470497|ref|YP_007729138.1| gi|478471388|ref|YP_007739991.1| gi|478452454|ref|YP_007720202.1| gi|478454259|ref|YP_007716638.1| gi|478464189|ref|YP_007740881.1| gi|166155320|ref|YP_001653575.1| 471472.CTL0486 471473.CTLon_0482 gi|166154445|ref|YP_001654563.1| gi|478450654|ref|YP_007721096.1| gi|527318046|ref|YP_008344248.1| WP_009873661.1.100883 WP_009873661.1.101735 WP_009873661.1.11148 WP_009873661.1.11732 WP_009873661.1.17082 WP_009873661.1.18643 WP_009873661.1.22210 WP_009873661.1.25195 WP_009873661.1.27753 WP_009873661.1.27980 WP_009873661.1.32801 WP_009873661.1.38181 WP_009873661.1.38794 WP_009873661.1.40464 WP_009873661.1.40808 WP_009873661.1.42718 WP_009873661.1.45552 WP_009873661.1.48923 WP_009873661.1.49465 WP_009873661.1.51159 WP_009873661.1.53299 WP_009873661.1.5416 WP_009873661.1.58046 WP_009873661.1.58308 WP_009873661.1.5967 WP_009873661.1.60427 WP_009873661.1.62489 WP_009873661.1.64162 WP_009873661.1.67104 WP_009873661.1.71307 WP_009873661.1.79775 WP_009873661.1.83642 WP_009873661.1.95142 WP_009873661.1.97423 WP_009873661.1.99598 YP_001654563.1.27483 gi|527327604|ref|YP_008353795.1| gi|527326676|ref|YP_008352868.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]