SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452462|ref|YP_007720210.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452462|ref|YP_007720210.1|
Domain Number 1 Region: 24-167
Classification Level Classification E-value
Superfamily OmpH-like 1.7e-26
Family OmpH-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452462|ref|YP_007720210.1|
Sequence length 173
Comment periplasmic chaperone [Chlamydia trachomatis L2b/Canada1]
Sequence
MKKFLLLSLMSLSSLPTFAANSTGTIGIVNLRRCLEESALGKKESAEFEKMKNQFSNSMG
KMEEELSSIYSKLQDDDYMEGLSETAAAELRKKFEDLSAEYNTAQGQYYQILNQSNLKRM
QKIMEEVKKASETVRIQEGLSVLLNEDIVLSIDSSADKTDAVIKVLDDSFQNN
Download sequence
Identical sequences A0A0E9D6X7 A0A0H2X0W0 A0A0H3MBT5 Q9ZN58
gi|478459693|ref|YP_007733761.1| gi|527326684|ref|YP_008352876.1| gi|15604963|ref|NP_219747.1| gi|385239753|ref|YP_005807595.1| gi|527325762|ref|YP_008351955.1| gi|478452462|ref|YP_007720210.1| gi|527319936|ref|YP_008346136.1| gi|478454267|ref|YP_007716646.1| 272561.CT242 315277.CTA_0264 471472.CTL0494 471473.CTLon_0490 580049.JALI_2371 672161.CTB_2371 gi|478455171|ref|YP_007727361.1| gi|339625901|ref|YP_004717380.1| gi|478464197|ref|YP_007740889.1| gi|166154453|ref|YP_001654571.1| gi|478466896|ref|YP_007718428.1| gi|385244329|ref|YP_005812173.1| gi|166155328|ref|YP_001653583.1| gi|478447961|ref|YP_007721995.1| gi|478457890|ref|YP_007731075.1| gi|385243449|ref|YP_005811295.1| gi|527328537|ref|YP_008354727.1| gi|527323703|ref|YP_008349899.1| gi|237802665|ref|YP_002887859.1| gi|478470505|ref|YP_007729146.1| gi|527324838|ref|YP_008351032.1| gi|478467797|ref|YP_007742670.1| gi|478449761|ref|YP_007719318.1| gi|478450662|ref|YP_007721104.1| gi|478465097|ref|YP_007741779.1| gi|527318054|ref|YP_008344256.1| gi|478469606|ref|YP_007722886.1| gi|478453375|ref|YP_007717537.1| gi|76788964|ref|YP_328050.1| gi|237804587|ref|YP_002888741.1| gi|482546544|ref|YP_007852460.1| gi|385242529|ref|YP_005810368.1| gi|478462400|ref|YP_007738221.1| gi|482545601|ref|YP_007851519.1| gi|478456979|ref|YP_007725572.1| gi|478475011|ref|YP_007724680.1| gi|527327612|ref|YP_008353803.1| gi|568111492|ref|YP_008921091.1| gi|527322744|ref|YP_008348941.1| gi|478463299|ref|YP_007739111.1| gi|478460596|ref|YP_007735547.1| gi|527318975|ref|YP_008345176.1| NP_219747.1.57406 WP_009871589.1.100644 WP_009871589.1.100883 WP_009871589.1.101362 WP_009871589.1.101735 WP_009871589.1.102133 WP_009871589.1.11148 WP_009871589.1.11732 WP_009871589.1.13674 WP_009871589.1.14984 WP_009871589.1.17082 WP_009871589.1.17422 WP_009871589.1.18643 WP_009871589.1.20093 WP_009871589.1.22210 WP_009871589.1.25195 WP_009871589.1.27753 WP_009871589.1.27980 WP_009871589.1.30792 WP_009871589.1.32801 WP_009871589.1.34934 WP_009871589.1.38181 WP_009871589.1.38504 WP_009871589.1.38794 WP_009871589.1.40464 WP_009871589.1.40808 WP_009871589.1.4264 WP_009871589.1.42718 WP_009871589.1.42889 WP_009871589.1.43504 WP_009871589.1.45552 WP_009871589.1.48923 WP_009871589.1.49465 WP_009871589.1.5036 WP_009871589.1.51159 WP_009871589.1.52091 WP_009871589.1.53299 WP_009871589.1.5416 WP_009871589.1.55117 WP_009871589.1.58046 WP_009871589.1.58308 WP_009871589.1.5967 WP_009871589.1.60427 WP_009871589.1.60937 WP_009871589.1.61004 WP_009871589.1.61683 WP_009871589.1.62489 WP_009871589.1.62968 WP_009871589.1.64162 WP_009871589.1.65391 WP_009871589.1.67104 WP_009871589.1.67250 WP_009871589.1.69355 WP_009871589.1.71307 WP_009871589.1.71619 WP_009871589.1.72034 WP_009871589.1.72164 WP_009871589.1.72442 WP_009871589.1.74323 WP_009871589.1.75470 WP_009871589.1.77651 WP_009871589.1.79775 WP_009871589.1.83525 WP_009871589.1.83642 WP_009871589.1.85365 WP_009871589.1.86066 WP_009871589.1.87079 WP_009871589.1.92427 WP_009871589.1.93216 WP_009871589.1.9343 WP_009871589.1.95142 WP_009871589.1.97423 WP_009871589.1.97602 WP_009871589.1.99598 YP_001654571.1.27483 gi|478447069|ref|YP_007715757.1| gi|385246139|ref|YP_005814961.1| gi|478451562|ref|YP_007714868.1| gi|385240674|ref|YP_005808515.1| gi|527321801|ref|YP_008347999.1| gi|478471396|ref|YP_007739999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]