SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452479|ref|YP_007720227.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452479|ref|YP_007720227.1|
Domain Number 1 Region: 6-247
Classification Level Classification E-value
Superfamily PP2C-like 1.28e-58
Family PP2C-like 0.0000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452479|ref|YP_007720227.1|
Sequence length 248
Comment putative protein serine/threonine phosphatase [Chlamydia trachomatis L2b/Canada1]
Sequence
MIVADFEYFGLSDVGLVRHNNEDFWQVNYDSQLIAIADGMGGHRAGAVASYEAVGNLMQL
VDLHKVDLERFGDEQYKESIKTIVSEVNLLIYRQGLSNEEFKGMGTTLSCMQFRRGKAWL
FHVGDCRVYRLRNKMLERLTEDHSLANHLASRYGLSKQSVKRYPGRNVLTNVLGSRPHVS
LDIREMSYEKEDLFVFCSDGLTSAVSDHDMLDILTQTTTLEEGGNILISLANSRGGRDNA
TVILVRMR
Download sequence
Identical sequences A0A0E9AQK1 A0A0H3MH06
gi|478454284|ref|YP_007716663.1| gi|478470522|ref|YP_007729163.1| gi|527326701|ref|YP_008352893.1| gi|482546561|ref|YP_007852477.1| gi|478447086|ref|YP_007715774.1| gi|478447978|ref|YP_007722012.1| gi|478464214|ref|YP_007740906.1| gi|166154470|ref|YP_001654588.1| gi|478463316|ref|YP_007739128.1| gi|166155345|ref|YP_001653600.1| gi|478466913|ref|YP_007718445.1| gi|478452479|ref|YP_007720227.1| gi|478465114|ref|YP_007741796.1| gi|482545618|ref|YP_007851536.1| gi|527325779|ref|YP_008351972.1| gi|527318071|ref|YP_008344273.1| gi|478451579|ref|YP_007714885.1| gi|478462417|ref|YP_007738238.1| gi|478467814|ref|YP_007742687.1| gi|527323720|ref|YP_008349916.1| gi|478449778|ref|YP_007719335.1| 471472.CTL0511 471473.CTLon_0507 gi|478450679|ref|YP_007721121.1| gi|339625918|ref|YP_004717397.1| gi|478471413|ref|YP_007740016.1| gi|527327629|ref|YP_008353820.1| WP_009873680.1.100883 WP_009873680.1.101735 WP_009873680.1.11148 WP_009873680.1.11732 WP_009873680.1.17082 WP_009873680.1.18643 WP_009873680.1.22210 WP_009873680.1.25195 WP_009873680.1.27753 WP_009873680.1.27980 WP_009873680.1.32801 WP_009873680.1.38181 WP_009873680.1.38794 WP_009873680.1.40464 WP_009873680.1.40808 WP_009873680.1.42718 WP_009873680.1.45552 WP_009873680.1.48923 WP_009873680.1.49465 WP_009873680.1.51159 WP_009873680.1.53299 WP_009873680.1.5416 WP_009873680.1.58046 WP_009873680.1.58308 WP_009873680.1.5967 WP_009873680.1.60427 WP_009873680.1.62489 WP_009873680.1.64162 WP_009873680.1.71307 WP_009873680.1.79775 WP_009873680.1.83642 WP_009873680.1.85365 WP_009873680.1.97423 WP_009873680.1.99598 YP_001654588.1.27483 gi|527321818|ref|YP_008348016.1| gi|478469623|ref|YP_007722903.1| gi|478453392|ref|YP_007717554.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]