SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452487|ref|YP_007720235.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452487|ref|YP_007720235.1|
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily IHF-like DNA-binding proteins 1.09e-22
Family Prokaryotic DNA-bending protein 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452487|ref|YP_007720235.1|
Sequence length 100
Comment integration host factor subunit beta [Chlamydia trachomatis L2b/Canada1]
Sequence
MATMTKKKLISTISQDHKIHPNHVRTVIQNFLDKMTDALVQGDRLEFRDFGVLQVVERKP
KVGRNPKNAAVPIHIPARRAVKFTPGKRMKRLIETPTKSS
Download sequence
Identical sequences A0A069ZTU2 A0A0E9D044 A0A0H2X0U2 A0A0H3MKX1 A0A1T4J0B9 P64386 P64387
243161.TC0538 272561.CT267 315277.CTA_0289 471472.CTL0519 471473.CTLon_0515 580049.JALI_2621 672161.CTB_2621 gi|385241633|ref|YP_005809473.1| gi|478473228|ref|YP_007734676.1| gi|478453400|ref|YP_007717562.1| gi|478475036|ref|YP_007724705.1| gi|385246164|ref|YP_005814986.1| gi|527324864|ref|YP_008351058.1| gi|389857957|ref|YP_006360199.1| gi|478458816|ref|YP_007732000.1| gi|478451587|ref|YP_007714893.1| gi|478449786|ref|YP_007719343.1| gi|478447986|ref|YP_007722020.1| gi|389859709|ref|YP_006361949.1| gi|237802690|ref|YP_002887884.1| gi|166155353|ref|YP_001653608.1| gi|568111518|ref|YP_008921117.1| gi|527320877|ref|YP_008347076.1| NP_219772.1.57406 WP_009871614.1.100466 WP_009871614.1.100644 WP_009871614.1.100883 WP_009871614.1.101362 WP_009871614.1.101735 WP_009871614.1.102133 WP_009871614.1.11148 WP_009871614.1.11520 WP_009871614.1.11717 WP_009871614.1.11732 WP_009871614.1.12853 WP_009871614.1.13674 WP_009871614.1.13766 WP_009871614.1.13837 WP_009871614.1.14786 WP_009871614.1.14984 WP_009871614.1.15381 WP_009871614.1.17082 WP_009871614.1.17422 WP_009871614.1.17696 WP_009871614.1.17869 WP_009871614.1.18643 WP_009871614.1.18971 WP_009871614.1.1923 WP_009871614.1.19304 WP_009871614.1.19393 WP_009871614.1.20022 WP_009871614.1.20093 WP_009871614.1.21797 WP_009871614.1.22210 WP_009871614.1.22489 WP_009871614.1.25024 WP_009871614.1.25195 WP_009871614.1.25246 WP_009871614.1.26538 WP_009871614.1.27753 WP_009871614.1.27980 WP_009871614.1.28239 WP_009871614.1.29171 WP_009871614.1.30792 WP_009871614.1.31128 WP_009871614.1.31373 WP_009871614.1.32156 WP_009871614.1.32801 WP_009871614.1.32856 WP_009871614.1.33964 WP_009871614.1.34934 WP_009871614.1.35043 WP_009871614.1.35053 WP_009871614.1.35600 WP_009871614.1.36244 WP_009871614.1.36518 WP_009871614.1.3661 WP_009871614.1.37219 WP_009871614.1.37417 WP_009871614.1.37673 WP_009871614.1.37956 WP_009871614.1.37979 WP_009871614.1.38181 WP_009871614.1.38504 WP_009871614.1.38794 WP_009871614.1.38813 WP_009871614.1.39258 WP_009871614.1.39979 WP_009871614.1.40272 WP_009871614.1.40339 WP_009871614.1.40464 WP_009871614.1.40808 WP_009871614.1.40903 WP_009871614.1.4187 WP_009871614.1.4264 WP_009871614.1.42718 WP_009871614.1.42889 WP_009871614.1.43504 WP_009871614.1.44223 WP_009871614.1.45552 WP_009871614.1.45721 WP_009871614.1.46238 WP_009871614.1.48072 WP_009871614.1.48551 WP_009871614.1.48923 WP_009871614.1.4939 WP_009871614.1.49465 WP_009871614.1.5036 WP_009871614.1.50423 WP_009871614.1.51159 WP_009871614.1.51530 WP_009871614.1.52091 WP_009871614.1.53299 WP_009871614.1.5416 WP_009871614.1.55117 WP_009871614.1.55138 WP_009871614.1.57520 WP_009871614.1.57533 WP_009871614.1.5790 WP_009871614.1.58046 WP_009871614.1.58308 WP_009871614.1.59580 WP_009871614.1.5967 WP_009871614.1.60427 WP_009871614.1.60880 WP_009871614.1.60937 WP_009871614.1.61004 WP_009871614.1.6151 WP_009871614.1.61683 WP_009871614.1.61983 WP_009871614.1.62239 WP_009871614.1.62489 WP_009871614.1.62510 WP_009871614.1.62968 WP_009871614.1.63773 WP_009871614.1.64162 WP_009871614.1.65182 WP_009871614.1.65391 WP_009871614.1.66489 WP_009871614.1.67104 WP_009871614.1.67250 WP_009871614.1.6748 WP_009871614.1.69188 WP_009871614.1.69355 WP_009871614.1.69519 WP_009871614.1.69991 WP_009871614.1.7063 WP_009871614.1.70894 WP_009871614.1.71137 WP_009871614.1.71307 WP_009871614.1.71619 WP_009871614.1.71686 WP_009871614.1.72034 WP_009871614.1.72164 WP_009871614.1.72442 WP_009871614.1.74323 WP_009871614.1.74635 WP_009871614.1.75470 WP_009871614.1.76012 WP_009871614.1.76381 WP_009871614.1.76931 WP_009871614.1.77153 WP_009871614.1.77651 WP_009871614.1.77803 WP_009871614.1.77980 WP_009871614.1.78375 WP_009871614.1.78927 WP_009871614.1.79775 WP_009871614.1.80487 WP_009871614.1.8146 WP_009871614.1.83525 WP_009871614.1.83642 WP_009871614.1.84294 WP_009871614.1.85209 WP_009871614.1.85256 WP_009871614.1.85365 WP_009871614.1.86066 WP_009871614.1.868 WP_009871614.1.87079 WP_009871614.1.87298 WP_009871614.1.87666 WP_009871614.1.88177 WP_009871614.1.88937 WP_009871614.1.89087 WP_009871614.1.9107 WP_009871614.1.91588 WP_009871614.1.92427 WP_009871614.1.93216 WP_009871614.1.9343 WP_009871614.1.93600 WP_009871614.1.95142 WP_009871614.1.96955 WP_009871614.1.97423 WP_009871614.1.97602 WP_009871614.1.99598 YP_001654596.1.27483 gi|478450687|ref|YP_007721129.1| gi|478460621|ref|YP_007735572.1| gi|76788989|ref|YP_328075.1| gi|527323729|ref|YP_008349925.1| gi|471328437|ref|YP_007539962.1| gi|478459718|ref|YP_007733786.1| gi|527327638|ref|YP_008353829.1| gi|478457915|ref|YP_007731100.1| gi|478469631|ref|YP_007722911.1| gi|339625927|ref|YP_004717406.1| gi|478454292|ref|YP_007716671.1| gi|237804612|ref|YP_002888766.1| gi|478457004|ref|YP_007725597.1| gi|478464222|ref|YP_007740914.1| gi|385244354|ref|YP_005812198.1| gi|527318079|ref|YP_008344281.1| gi|478467822|ref|YP_007742695.1| gi|478465122|ref|YP_007741804.1| gi|478452487|ref|YP_007720235.1| gi|478447094|ref|YP_007715782.1| gi|482546570|ref|YP_007852486.1| gi|15604988|ref|NP_219772.1| gi|478456111|ref|YP_007726494.1| gi|478448888|ref|YP_007723811.1| gi|478474132|ref|YP_007730208.1| gi|482545627|ref|YP_007851545.1| gi|478461517|ref|YP_007736467.1| gi|527325788|ref|YP_008351981.1| gi|478455196|ref|YP_007727386.1| gi|527322769|ref|YP_008348966.1| gi|389858833|ref|YP_006361074.1| gi|478470530|ref|YP_007729171.1| gi|478463324|ref|YP_007739136.1| gi|15835156|ref|NP_296915.1| gi|478466921|ref|YP_007718453.1| gi|385243474|ref|YP_005811320.1| gi|478462425|ref|YP_007738246.1| gi|478471421|ref|YP_007740024.1| gi|527328562|ref|YP_008354752.1| gi|527326710|ref|YP_008352902.1| gi|385242554|ref|YP_005810393.1| gi|385240700|ref|YP_005808541.1| gi|386262618|ref|YP_005815897.1| gi|527321827|ref|YP_008348025.1| gi|478428398|ref|YP_007540838.1| gi|527319001|ref|YP_008345202.1| gi|478472326|ref|YP_007732893.1| gi|166154478|ref|YP_001654596.1| gi|527319961|ref|YP_008346161.1| gi|385239778|ref|YP_005807620.1| gi|385245240|ref|YP_005814063.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]