SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452489|ref|YP_007720237.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452489|ref|YP_007720237.1|
Domain Number 1 Region: 98-319
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.28e-64
Family MurCDEF 0.00022
Further Details:      
 
Domain Number 2 Region: 329-480
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.47e-39
Family MurCDEF C-terminal domain 0.0000913
Further Details:      
 
Domain Number 3 Region: 1-98
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 1.31e-19
Family MurE/MurF N-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452489|ref|YP_007720237.1|
Sequence length 483
Comment UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase [Chlamydia trachomatis L2b/Canada1]
Sequence
MHLDQLLRNIPAKIYGKVESIPVRNLTRDSRCVGVGDIFIARQGQFCNGNDYSSQAVANG
AIAVLSSLYNPFLSVVQIIAEDPIALEASLAARFYNNPSKHLDVIGITGTNGKTTVSCLV
RELMERSGIRTGLIGTIEHILGENRIVDSFTTPDAILLQKYFAEMVKQNLSAAVMEVSSI
GMALGRVRETEFLAGVLTNITSDHLDFHGSLEEYIAAKKQFFASLPEKGIAVVNLDCEYA
PSFLNGSQARAVSYAIHQEADYRADRLKLYSSGSSYDIWYQGKVFPCETSLIGEHNVYNV
LASLAVVHQFLGGDFADLVRDVRFLSAPKGRLDPILLGPFPVYIDYAHTPDALDNVCRIL
LQLLPKYGRLIIVFGCGGDRDRVKRPLMAKVSEHYGFSFVTSDNPRTEDPDQIIADICKG
FSTDHYVVESDRKLAIEKAISMASDKDIVLVAGKGHEGYQIFKHQTIVFDDREVVCEALA
ALC
Download sequence
Identical sequences A0A0E9AYS9 A0A0H3MBW4
gi|478464224|ref|YP_007740916.1| gi|478469633|ref|YP_007722913.1| gi|478451589|ref|YP_007714895.1| gi|478454294|ref|YP_007716673.1| gi|478447988|ref|YP_007722022.1| WP_009873687.1.100883 WP_009873687.1.101735 WP_009873687.1.11148 WP_009873687.1.11732 WP_009873687.1.17082 WP_009873687.1.18643 WP_009873687.1.22210 WP_009873687.1.25195 WP_009873687.1.27753 WP_009873687.1.27980 WP_009873687.1.32801 WP_009873687.1.38181 WP_009873687.1.38794 WP_009873687.1.40464 WP_009873687.1.40808 WP_009873687.1.42718 WP_009873687.1.45552 WP_009873687.1.48923 WP_009873687.1.49465 WP_009873687.1.51159 WP_009873687.1.53299 WP_009873687.1.5416 WP_009873687.1.58308 WP_009873687.1.5967 WP_009873687.1.60427 WP_009873687.1.62489 WP_009873687.1.64162 WP_009873687.1.71307 WP_009873687.1.79775 WP_009873687.1.83642 WP_009873687.1.85365 WP_009873687.1.97423 WP_009873687.1.99598 YP_001654598.1.27483 gi|478453402|ref|YP_007717564.1| gi|478471423|ref|YP_007740026.1| gi|478447096|ref|YP_007715784.1| gi|478467824|ref|YP_007742697.1| gi|478452489|ref|YP_007720237.1| gi|166154480|ref|YP_001654598.1| gi|478470532|ref|YP_007729173.1| gi|478465124|ref|YP_007741806.1| gi|166155355|ref|YP_001653610.1| gi|482546572|ref|YP_007852488.1| gi|527327640|ref|YP_008353831.1| gi|527323731|ref|YP_008349927.1| gi|527326712|ref|YP_008352904.1| gi|478450689|ref|YP_007721131.1| gi|478463326|ref|YP_007739138.1| gi|527325790|ref|YP_008351983.1| 471472.CTL0521 471473.CTLon_0517 gi|527321829|ref|YP_008348027.1| gi|478462427|ref|YP_007738248.1| gi|482545629|ref|YP_007851547.1| gi|339625929|ref|YP_004717408.1| gi|478466923|ref|YP_007718455.1| gi|478449788|ref|YP_007719345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]