SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452506|ref|YP_007720254.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452506|ref|YP_007720254.1|
Domain Number 1 Region: 187-497
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-75
Family Extended AAA-ATPase domain 0.0000000383
Further Details:      
 
Domain Number 2 Region: 512-810
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-69
Family Extended AAA-ATPase domain 0.000000045
Further Details:      
 
Domain Number 3 Region: 3-139
Classification Level Classification E-value
Superfamily Double Clp-N motif 7.2e-29
Family Double Clp-N motif 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452506|ref|YP_007720254.1|
Sequence length 854
Comment protein disaggregation chaperone [Chlamydia trachomatis L2b/Canada1]
Sequence
MFEKFTNRAKQVIKLAKKEAQRLNHNYLGTEHILLGLLKLGQGVAVNVLRTLGVDFDTAK
HEVERLIGYGPEIQVYGDPALTGRVKKSFESANEEAALLEHNYVGTEHLLLGILNQSDGV
ALQVLENLHVDPKEIRKEILKELETFNLQLPPSSSITPRNTNSSSSSKSSSPLGGHTLGG
DKPEKLSALKAYGYDLTEMFKESRLDPVIGRSAEVERLILILCRRRKNNPVLVGEAGVGK
TAIVEGLAQKIVSGEVPEALRKKRLITLDLALMIAGTKYRGQFEERIKAVMDEVRKHGNI
LLFIDELHTIVGAGAAEGAIDASHILKPALARGEIQCIGATTLDEYRKHIEKDAALERRF
QKIVVQPPSVDETVEILRGLKKKYEEHHNVFITDEALVAAAKLSDQYVHGRFLPDKAIDL
LDEAGARVRVNTMGQPSDLMRLEAEIEKTKQAKEQAIGTQEYEKAASLRDEEKKLREKLG
NMKQQWESNKEEHQVPVDEEAVAQVVSVQTGIPAARLTEAESEKLLTLETTLQKKVIGQS
QAVASICRAIRRSRTGIKDPNRPMGSFLFLGPTGVGKTLLAQQIAIEMFGGEDSLIQVDM
SEYMEKFAATKMMGSPPGYVGHEEGGHLTEQVRRRPYCVVLFDEIEKAHPDIMDLMLQIL
EQGRLTDSFGRKIDFRNTIIIMTSNLGADLIRKSGEIGFGLRSHMDYAVIKEKIDAAVKK
HLKPEFINRLDESVIFKPLEKEALSEIIHLEINKLGSRLQNYQMDLNIPDSVISFLVTKG
HSPEMGARPLRRVVEQYLEDPLAEMLLKESCRQEARKLRARLTEERVVFEREEEAVSALA
IEGDGSEPITADES
Download sequence
Identical sequences A0A0E9AUI5 A0A0H3MDC5
gi|478452506|ref|YP_007720254.1| gi|527326729|ref|YP_008352921.1| gi|478447113|ref|YP_007715801.1| gi|478449805|ref|YP_007719362.1| gi|478463343|ref|YP_007739155.1| gi|482545645|ref|YP_007851563.1| 471472.CTL0538 471473.CTLon_0534 gi|478454311|ref|YP_007716690.1| gi|478465141|ref|YP_007741823.1| gi|527325807|ref|YP_008352000.1| gi|478471440|ref|YP_007740043.1| WP_009873700.1.100883 WP_009873700.1.101735 WP_009873700.1.11148 WP_009873700.1.11732 WP_009873700.1.17082 WP_009873700.1.18643 WP_009873700.1.22210 WP_009873700.1.25195 WP_009873700.1.27753 WP_009873700.1.27980 WP_009873700.1.32801 WP_009873700.1.38181 WP_009873700.1.38794 WP_009873700.1.40464 WP_009873700.1.40808 WP_009873700.1.42718 WP_009873700.1.45552 WP_009873700.1.48923 WP_009873700.1.49465 WP_009873700.1.51159 WP_009873700.1.53299 WP_009873700.1.5416 WP_009873700.1.58308 WP_009873700.1.5967 WP_009873700.1.60427 WP_009873700.1.60937 WP_009873700.1.62489 WP_009873700.1.64162 WP_009873700.1.71307 WP_009873700.1.79775 WP_009873700.1.83642 WP_009873700.1.85365 WP_009873700.1.9343 WP_009873700.1.97423 WP_009873700.1.97602 WP_009873700.1.99598 YP_001654615.1.27483 gi|385239797|ref|YP_005807639.1| gi|339625948|ref|YP_004717427.1| gi|478462444|ref|YP_007738265.1| gi|166154497|ref|YP_001654615.1| gi|478450706|ref|YP_007721148.1| gi|478466940|ref|YP_007718472.1| gi|478467841|ref|YP_007742714.1| gi|478451606|ref|YP_007714912.1| gi|478448005|ref|YP_007722039.1| gi|385242573|ref|YP_005810412.1| gi|527323748|ref|YP_008349944.1| gi|478469650|ref|YP_007722930.1| gi|482546588|ref|YP_007852504.1| gi|385246183|ref|YP_005815005.1| gi|478464241|ref|YP_007740933.1| gi|478470549|ref|YP_007729190.1| gi|478453419|ref|YP_007717581.1| gi|166155372|ref|YP_001653627.1| gi|527321846|ref|YP_008348044.1| gi|527327657|ref|YP_008353848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]