SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452510|ref|YP_007720258.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452510|ref|YP_007720258.1|
Domain Number 1 Region: 77-220
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 5.89e-26
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00099
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000476
Family Terminase gpNU1 subunit domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452510|ref|YP_007720258.1|
Sequence length 225
Comment PTS system sugar transporter subunit IIA [Chlamydia trachomatis L2b/Canada1]
Sequence
MDLRLDQLAVLLDVAEDSIRQWVSCGGIPSYTINDELRFNREEVEDWLIHNHGVIPDEKR
EEKGESKDLSLRYSLYRAIYRGGVLKNVLVDSKEGALRYAAHYIANKFELDPVVLFEMLM
HRESLMSTGIGEGIALPHAKDFLINVGYDIIVPVFLSQSIEYGALDGKPVDTLFFLFANQ
DRNHLNLVNKIVHLGMSIQARLFLKEHPDQPQLLAFVKNWEAQIH
Download sequence
Identical sequences A0A0E9FYH3 A0A0H3MBX9
gi|478450710|ref|YP_007721152.1| gi|527326733|ref|YP_008352925.1| gi|527327661|ref|YP_008353852.1| gi|478471444|ref|YP_007740047.1| gi|478449809|ref|YP_007719366.1| gi|478447117|ref|YP_007715805.1| gi|478469654|ref|YP_007722934.1| gi|478453423|ref|YP_007717585.1| gi|527325811|ref|YP_008352004.1| gi|478467845|ref|YP_007742718.1| gi|527319985|ref|YP_008346185.1| gi|478452510|ref|YP_007720258.1| gi|478451610|ref|YP_007714916.1| gi|166155376|ref|YP_001653631.1| gi|478463347|ref|YP_007739159.1| gi|482545649|ref|YP_007851567.1| gi|478454315|ref|YP_007716694.1| gi|478464245|ref|YP_007740937.1| gi|478465145|ref|YP_007741827.1| WP_009873704.1.100883 WP_009873704.1.101735 WP_009873704.1.11148 WP_009873704.1.11732 WP_009873704.1.17082 WP_009873704.1.18643 WP_009873704.1.22210 WP_009873704.1.25195 WP_009873704.1.27753 WP_009873704.1.27980 WP_009873704.1.32801 WP_009873704.1.38181 WP_009873704.1.38794 WP_009873704.1.40464 WP_009873704.1.40808 WP_009873704.1.42718 WP_009873704.1.45552 WP_009873704.1.48923 WP_009873704.1.49465 WP_009873704.1.51159 WP_009873704.1.53299 WP_009873704.1.5416 WP_009873704.1.58308 WP_009873704.1.5967 WP_009873704.1.60427 WP_009873704.1.62489 WP_009873704.1.64162 WP_009873704.1.71307 WP_009873704.1.79775 WP_009873704.1.83642 WP_009873704.1.85365 WP_009873704.1.87079 WP_009873704.1.97423 WP_009873704.1.99598 YP_001654619.1.27483 gi|478470553|ref|YP_007729194.1| 471472.CTL0542 471473.CTLon_0538 gi|478462448|ref|YP_007738269.1| gi|527321850|ref|YP_008348048.1| gi|478466944|ref|YP_007718476.1| gi|478448009|ref|YP_007722043.1| gi|482546592|ref|YP_007852508.1| gi|166154501|ref|YP_001654619.1| gi|527323753|ref|YP_008349949.1| gi|339625952|ref|YP_004717431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]