SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452540|ref|YP_007720288.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452540|ref|YP_007720288.1|
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.75e-31
Family N-utilization substance G protein NusG, N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 118-175
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000000173
Family N-utilization substance G protein NusG, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452540|ref|YP_007720288.1|
Sequence length 182
Comment transcription antitermination protein NusG [Chlamydia trachomatis L2b/Canada1]
Sequence
MFKWYVVQVFTAQEKKVKKSLEDFKEASGMSDFIQQIILPSENVMEVKKGEHKIVEKYIW
PGYLLVKMHLTDESWSYVKKTQGVVEFLGGGAPVALSEEEIKNILADLEEKKSGVVQKHK
FEVGSQVKINDGVFVNFVGVVSEVFHDKGRLSVMVSIFGRETRVDDLEFWQVEEVVPGQE
SE
Download sequence
Identical sequences A0A0E9APX0 A0A0H3MBY9
gi|478449839|ref|YP_007719396.1| gi|478465175|ref|YP_007741857.1| gi|478470583|ref|YP_007729224.1| gi|478463377|ref|YP_007739189.1| gi|478466974|ref|YP_007718506.1| gi|478454345|ref|YP_007716724.1| gi|478451640|ref|YP_007714946.1| gi|166154530|ref|YP_001654648.1| gi|478469684|ref|YP_007722964.1| gi|478462478|ref|YP_007738299.1| gi|482545679|ref|YP_007851597.1| WP_009873722.1.100883 WP_009873722.1.101735 WP_009873722.1.11732 WP_009873722.1.17082 WP_009873722.1.18643 WP_009873722.1.25195 WP_009873722.1.27753 WP_009873722.1.38181 WP_009873722.1.38794 WP_009873722.1.40464 WP_009873722.1.40808 WP_009873722.1.42718 WP_009873722.1.45552 WP_009873722.1.48923 WP_009873722.1.49465 WP_009873722.1.51159 WP_009873722.1.53299 WP_009873722.1.5416 WP_009873722.1.58308 WP_009873722.1.5967 WP_009873722.1.62489 WP_009873722.1.64162 WP_009873722.1.71307 WP_009873722.1.79775 WP_009873722.1.83642 WP_009873722.1.85365 WP_009873722.1.97423 WP_009873722.1.99598 YP_001654648.1.27483 gi|478450740|ref|YP_007721182.1| gi|478471474|ref|YP_007740077.1| gi|478448039|ref|YP_007722073.1| gi|478447147|ref|YP_007715835.1| gi|166155405|ref|YP_001653660.1| gi|482546622|ref|YP_007852538.1| gi|339625984|ref|YP_004717463.1| gi|478453453|ref|YP_007717615.1| gi|478452540|ref|YP_007720288.1| 471472.CTL0572 471473.CTLon_0568 gi|478464275|ref|YP_007740967.1| gi|478467875|ref|YP_007742748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]