SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452572|ref|YP_007720320.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452572|ref|YP_007720320.1|
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily ITPase-like 3.01e-48
Family Maf-like 0.000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452572|ref|YP_007720320.1|
Sequence length 196
Comment Maf-like protein [Chlamydia trachomatis L2b/Canada1]
Sequence
MEARLVLGSSSERRKAVLESFRIPFICVSPDFDERSIVYSGDPFKYTKELAWNKANVVRS
QGFSDALIITADTVVVYKGEVFNKPESEEHAVEMLRTLSGSSHSVITTLVLMQNEKVLSA
SENTQVSFIDIPPQHLKTYVRSFSSLKRCGGYCVQDGGGLIIKQIEGCVYNIQGLPIKTL
NQLLMEFNISLWDYLV
Download sequence
Identical sequences A0A0E9AQA6 B0B7R8 B0BBY3
gi|527319088|ref|YP_008345289.1| gi|478451672|ref|YP_007714978.1| gi|478465207|ref|YP_007741889.1| gi|478452572|ref|YP_007720320.1| gi|482546655|ref|YP_007852571.1| gi|478467907|ref|YP_007742780.1| gi|166154561|ref|YP_001654679.1| gi|527327724|ref|YP_008353915.1| gi|478449871|ref|YP_007719428.1| gi|478467006|ref|YP_007718538.1| gi|478470615|ref|YP_007729256.1| gi|478454377|ref|YP_007716756.1| gi|478471506|ref|YP_007740109.1| gi|527326797|ref|YP_008352989.1| gi|478450772|ref|YP_007721214.1| gi|478464307|ref|YP_007740999.1| gi|527321914|ref|YP_008348112.1| gi|478448072|ref|YP_007722106.1| gi|478469716|ref|YP_007722996.1| 471472.CTL0603 471473.CTLon_0601 gi|527325876|ref|YP_008352069.1| gi|478462511|ref|YP_007738332.1| gi|166155436|ref|YP_001653691.1| gi|527328649|ref|YP_008354839.1| gi|478447180|ref|YP_007715868.1| gi|527323817|ref|YP_008350013.1| gi|478453485|ref|YP_007717647.1| WP_009873746.1.100883 WP_009873746.1.101735 WP_009873746.1.11148 WP_009873746.1.11732 WP_009873746.1.17082 WP_009873746.1.18643 WP_009873746.1.22210 WP_009873746.1.25195 WP_009873746.1.27753 WP_009873746.1.27980 WP_009873746.1.32801 WP_009873746.1.38181 WP_009873746.1.38794 WP_009873746.1.40464 WP_009873746.1.40808 WP_009873746.1.42718 WP_009873746.1.45552 WP_009873746.1.48923 WP_009873746.1.49465 WP_009873746.1.51159 WP_009873746.1.53299 WP_009873746.1.5416 WP_009873746.1.58046 WP_009873746.1.58308 WP_009873746.1.5967 WP_009873746.1.60427 WP_009873746.1.61004 WP_009873746.1.62489 WP_009873746.1.64162 WP_009873746.1.67104 WP_009873746.1.71307 WP_009873746.1.79775 WP_009873746.1.83642 WP_009873746.1.85365 WP_009873746.1.95142 WP_009873746.1.97423 WP_009873746.1.99598 YP_001654679.1.27483 gi|339626019|ref|YP_004717498.1| gi|482545712|ref|YP_007851630.1| gi|527318167|ref|YP_008344369.1| gi|478463410|ref|YP_007739222.1| gi|527324951|ref|YP_008351145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]