SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452573|ref|YP_007720321.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452573|ref|YP_007720321.1|
Domain Number 1 Region: 81-302
Classification Level Classification E-value
Superfamily ARM repeat 1.23e-22
Family Armadillo repeat 0.052
Further Details:      
 
Weak hits

Sequence:  gi|478452573|ref|YP_007720321.1|
Domain Number - Region: 346-393
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0203
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Domain Number - Region: 403-473
Classification Level Classification E-value
Superfamily ARM repeat 0.042
Family Armadillo repeat 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452573|ref|YP_007720321.1|
Sequence length 566
Comment hypothetical protein L2BCAN1_00363 [Chlamydia trachomatis L2b/Canada1]
Sequence
MGLSRLAFIGFLSFTLSASCDFPSSVSQRILFSCQKSVPQALEAYLEASATYQQHDFSVL
RVIAESYLQQSFLSEDTHIRKSAIIGAGLSGSSEALELLSEAIETQDLYEQLLILNAATS
QLSKTSDKLLFKGLTASHPVIRLEAAYRLACMKNSKVSDYLYSFIYKLPEEIQNLAATIF
LQLETEEADAYIHRLLSSPNNLTRNYVAYLIGEYKQKRFLPTLRSLLTSASPLDQEGALY
ALGKLEDSGSYPRIKALSSRSNPEVVLAAAQTLLFLEKEEEALPILTNLCQQKLLRALYT
ARFLSQEKGEELLLPIFYNATQEEIRLNTALALVHQGCTDPQVLHYLTEILESKVLHRIF
LPTHSTGKAIQFWKECTTFPLMSQEDKMRTLAMYRVAEDTILSALLKLPNDAYLPYLERI
LASQKTILAAKAIAFLSVTAHPQALSLVSKAALTPGDPIIRAYANLALYTMTKDPEKKAV
LYRYAEQLIEDTILFTDAENPLPSPSSSYLRYQVSPETRTQLMLAILETLVSSKTDEDIR
VFLSLMKKTHYKNIPILSGLLMRIVE
Download sequence
Identical sequences A0A0E9APT4
471473.CTLon_0602 gi|478448073|ref|YP_007722107.1| gi|478467908|ref|YP_007742781.1| gi|478462512|ref|YP_007738333.1| gi|478463411|ref|YP_007739223.1| gi|478469717|ref|YP_007722997.1| gi|478454378|ref|YP_007716757.1| gi|166155437|ref|YP_001653692.1| gi|478470616|ref|YP_007729257.1| gi|478452573|ref|YP_007720321.1| gi|478465208|ref|YP_007741890.1| WP_012263643.1.101735 WP_012263643.1.11732 WP_012263643.1.18643 WP_012263643.1.25195 WP_012263643.1.27753 WP_012263643.1.38181 WP_012263643.1.38794 WP_012263643.1.40464 WP_012263643.1.42718 WP_012263643.1.45552 WP_012263643.1.48923 WP_012263643.1.49465 WP_012263643.1.51159 WP_012263643.1.53299 WP_012263643.1.5416 WP_012263643.1.58308 WP_012263643.1.5967 WP_012263643.1.64162 WP_012263643.1.79775 WP_012263643.1.97423 gi|478471507|ref|YP_007740110.1| gi|478467007|ref|YP_007718539.1| gi|478464308|ref|YP_007741000.1| gi|478453486|ref|YP_007717648.1| gi|478451673|ref|YP_007714979.1| gi|478450773|ref|YP_007721215.1| gi|478449872|ref|YP_007719429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]