SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452618|ref|YP_007720366.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452618|ref|YP_007720366.1|
Domain Number 1 Region: 11-237,407-478
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.07e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00059
Further Details:      
 
Domain Number 2 Region: 255-386
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 2.62e-27
Family YbaK/ProRS associated domain 0.0048
Further Details:      
 
Domain Number 3 Region: 463-566
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9.49e-22
Family Anticodon-binding domain of Class II aaRS 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452618|ref|YP_007720366.1|
Sequence length 581
Comment prolyl-tRNA synthetase [Chlamydia trachomatis L2b/Canada1]
Sequence
MRTSLLFYRTSKNANKEASVLSYELLQKAGYLFKTSKGIYSYTPLFQRVILKMTEIIREE
LNAIGGQEVCLPLLQPAELWEKTGRWKAFLSEKLLYVLKDRENKAMCLAPTHEEVVSEFV
AQWLTGREQLPIHLYQIGTKFRDEIRPRFGLMRAKEFLMEDSYTFSDSPEQMEEQYAKLR
LAYQRIFDRLNLKYVIVAADGGKIGKGKSEEFHVLCSLGEDTICVSGSYGANVEAAQAIP
PSYVYDSNLLPVEEVATPNIRTIEDLEVFFNTPKHKILKTLVVKTRQKDSEKFFAICIRG
DRQINLTKVASFLQVDDCELASEEEILKHLHVEKGFIGPLYCPIPCYADETTRPMTNFIC
ANNQKDVHCKHVNWGRDIPLPAFGDFLLAEAGDLCPQNGGAPYEIFQGVEVAHIFNLGTR
YTESFSVGFQDKNGDKQLCWMGTYGIGVGRTLAACIEQLADNKGLVWPLAVAPFSITILY
NGGDTEGEATALQLYQSLNTEGFEPLLDDRNERLGFKLKDSDLLGIPYKLIIGKSFQSTG
LLEIESRSGEKCNVSPENLLDWCSKNLPCHTRKIPPLREQN
Download sequence
Identical sequences A0A0E9G1U2 B0B7W3 B0BC28
gi|478471552|ref|YP_007740155.1| gi|482546703|ref|YP_007852619.1| gi|478465253|ref|YP_007741935.1| gi|478462557|ref|YP_007738378.1| gi|478450818|ref|YP_007721260.1| gi|478464353|ref|YP_007741045.1| gi|527326843|ref|YP_008353035.1| gi|527327770|ref|YP_008353961.1| 471472.CTL0649 471473.CTLon_0646 gi|478451718|ref|YP_007715024.1| gi|478454423|ref|YP_007716802.1| gi|478467052|ref|YP_007718584.1| gi|166155479|ref|YP_001653734.1| gi|478453531|ref|YP_007717693.1| gi|478467953|ref|YP_007742826.1| gi|478447226|ref|YP_007715914.1| gi|478463456|ref|YP_007739268.1| gi|527325922|ref|YP_008352115.1| gi|527318214|ref|YP_008344416.1| gi|478449917|ref|YP_007719474.1| gi|527328695|ref|YP_008354885.1| WP_009873780.1.100883 WP_009873780.1.101735 WP_009873780.1.11148 WP_009873780.1.11732 WP_009873780.1.17082 WP_009873780.1.18643 WP_009873780.1.22210 WP_009873780.1.25195 WP_009873780.1.27753 WP_009873780.1.27980 WP_009873780.1.32801 WP_009873780.1.38181 WP_009873780.1.38794 WP_009873780.1.40464 WP_009873780.1.40808 WP_009873780.1.42718 WP_009873780.1.45552 WP_009873780.1.48923 WP_009873780.1.49465 WP_009873780.1.51159 WP_009873780.1.53299 WP_009873780.1.5416 WP_009873780.1.58046 WP_009873780.1.58308 WP_009873780.1.5967 WP_009873780.1.60427 WP_009873780.1.61004 WP_009873780.1.62489 WP_009873780.1.64162 WP_009873780.1.71307 WP_009873780.1.79775 WP_009873780.1.83642 WP_009873780.1.85365 WP_009873780.1.97423 WP_009873780.1.99598 YP_001654722.1.27483 gi|478469762|ref|YP_007723042.1| gi|482545759|ref|YP_007851677.1| gi|478470661|ref|YP_007729302.1| gi|527323864|ref|YP_008350060.1| gi|478448118|ref|YP_007722152.1| gi|166154604|ref|YP_001654722.1| gi|478452618|ref|YP_007720366.1| gi|339626066|ref|YP_004717545.1| gi|527321960|ref|YP_008348158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]