SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452661|ref|YP_007720409.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452661|ref|YP_007720409.1|
Domain Number 1 Region: 9-207
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.38e-36
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 207-350
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.88e-32
Family NADPH-cytochrome p450 reductase-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452661|ref|YP_007720409.1|
Sequence length 350
Comment sulfite reductase [Chlamydia trachomatis L2b/Canada1]
Sequence
MSLFSKFKAQWMFLHSRELCSSTSDIGNTCSDPVFQILCNPVRSEISYKVGDSLGVFPTN
PSTLVDSVLDALQYGPRSPVVSRHADSVLPLHEFLTSYVDLDKIPKSLRPFFPGDLDDTW
SLAEAILVYQPRIPFEEFIRSAMPLLPRFYSIASSPTCSHGKLELLVRCVSFQGKTQLRY
GLCSAFLCKDLQEGESFRGFIQPTRHFTLEQKNFGKPLIMIGAGTGIAPYKGFLQHRIYH
QDVGSNILFFGERFEKSNFYYRDFLQELIVSGKLQLFTAFSRDSESKLYVQNVIEQQKEL
IQEVYEQEAFFFVCGKKILGTEVKRALEQILGPKAVRELIAQKRLVSDVY
Download sequence
Identical sequences A0A0E9DQ28 A0A0H3MCH1
gi|339626113|ref|YP_004717592.1| gi|166154648|ref|YP_001654766.1| gi|478463500|ref|YP_007739312.1| gi|527322005|ref|YP_008348203.1| gi|478469806|ref|YP_007723086.1| gi|478450862|ref|YP_007721304.1| WP_009873809.1.100883 WP_009873809.1.101735 WP_009873809.1.11148 WP_009873809.1.11732 WP_009873809.1.17082 WP_009873809.1.18643 WP_009873809.1.22210 WP_009873809.1.25195 WP_009873809.1.27753 WP_009873809.1.32801 WP_009873809.1.38181 WP_009873809.1.38794 WP_009873809.1.40464 WP_009873809.1.40808 WP_009873809.1.42718 WP_009873809.1.45552 WP_009873809.1.48923 WP_009873809.1.49465 WP_009873809.1.51159 WP_009873809.1.53299 WP_009873809.1.5416 WP_009873809.1.58046 WP_009873809.1.58308 WP_009873809.1.5967 WP_009873809.1.60427 WP_009873809.1.62489 WP_009873809.1.64162 WP_009873809.1.71307 WP_009873809.1.79775 WP_009873809.1.83642 WP_009873809.1.85365 WP_009873809.1.97423 WP_009873809.1.99598 YP_001654766.1.27483 gi|482546749|ref|YP_007852665.1| gi|478470705|ref|YP_007729346.1| gi|478447271|ref|YP_007715959.1| gi|478451762|ref|YP_007715068.1| gi|527323909|ref|YP_008350105.1| gi|478464397|ref|YP_007741089.1| gi|478452661|ref|YP_007720409.1| gi|478465297|ref|YP_007741979.1| gi|478449961|ref|YP_007719518.1| gi|478453575|ref|YP_007717737.1| gi|478454467|ref|YP_007716846.1| gi|527326889|ref|YP_008353081.1| gi|527327816|ref|YP_008354007.1| gi|478471596|ref|YP_007740199.1| gi|478467997|ref|YP_007742870.1| gi|478448163|ref|YP_007722197.1| 471472.CTL0694 471473.CTLon_0690 gi|478462601|ref|YP_007738422.1| gi|527318259|ref|YP_008344461.1| gi|478467096|ref|YP_007718628.1| gi|482545805|ref|YP_007851723.1| gi|166155523|ref|YP_001653778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]