SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452673|ref|YP_007720421.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|478452673|ref|YP_007720421.1|
Domain Number - Region: 99-149
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000232
Family DNA-binding N-terminal domain of transcription activators 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452673|ref|YP_007720421.1|
Sequence length 183
Comment DNA binding domain, excisionase family [Chlamydia trachomatis L2b/Canada1]
Sequence
MECLQQDTGVEAEQVQVQQQEENAVPVTSQRVSITQAAKLHNVTRQAIYVAIKQKKLKAS
KTTRWEIDLQDLEDYRRNRYSRAKSTYQGELLFDNEKGFYSVGQVASMLDVPEQKIYYAT
RIGAMKGERRGSAWVIHVSEVDRYRNDYLKKEAERKGKSLAAMREGFEALGADLLADAEN
FIS
Download sequence
Identical sequences A0A0E9E157 A0A0H2X2I7 A0A0H3MC90 O84452
gi|478449078|ref|YP_007724001.1| gi|478459906|ref|YP_007733974.1| gi|385239967|ref|YP_005807809.1| gi|166155535|ref|YP_001653790.1| gi|478458103|ref|YP_007731288.1| gi|527327828|ref|YP_008354019.1| gi|478448175|ref|YP_007722209.1| gi|527322960|ref|YP_008349157.1| gi|237804796|ref|YP_002888950.1| gi|478450874|ref|YP_007721316.1| gi|385242745|ref|YP_005810584.1| gi|527318271|ref|YP_008344473.1| gi|527320151|ref|YP_008346351.1| gi|478453587|ref|YP_007717749.1| gi|478462613|ref|YP_007738434.1| gi|166154660|ref|YP_001654778.1| gi|478459006|ref|YP_007732190.1| gi|478475225|ref|YP_007724894.1| gi|527323921|ref|YP_008350117.1| gi|482545817|ref|YP_007851735.1| gi|478464409|ref|YP_007741101.1| gi|478457194|ref|YP_007725787.1| gi|385240891|ref|YP_005808732.1| gi|478454479|ref|YP_007716858.1| NP_219959.1.57406 WP_009871802.1.100644 WP_009871802.1.100883 WP_009871802.1.101362 WP_009871802.1.101735 WP_009871802.1.102133 WP_009871802.1.11148 WP_009871802.1.11732 WP_009871802.1.13674 WP_009871802.1.13766 WP_009871802.1.14984 WP_009871802.1.17082 WP_009871802.1.17422 WP_009871802.1.18643 WP_009871802.1.20093 WP_009871802.1.22210 WP_009871802.1.25195 WP_009871802.1.27753 WP_009871802.1.27980 WP_009871802.1.30792 WP_009871802.1.31128 WP_009871802.1.32801 WP_009871802.1.34934 WP_009871802.1.38181 WP_009871802.1.38504 WP_009871802.1.38794 WP_009871802.1.40464 WP_009871802.1.40808 WP_009871802.1.4264 WP_009871802.1.42718 WP_009871802.1.42889 WP_009871802.1.43504 WP_009871802.1.45552 WP_009871802.1.48923 WP_009871802.1.49465 WP_009871802.1.5036 WP_009871802.1.51159 WP_009871802.1.52091 WP_009871802.1.53299 WP_009871802.1.5416 WP_009871802.1.55117 WP_009871802.1.58046 WP_009871802.1.58308 WP_009871802.1.5967 WP_009871802.1.60427 WP_009871802.1.60937 WP_009871802.1.61004 WP_009871802.1.6151 WP_009871802.1.61683 WP_009871802.1.62239 WP_009871802.1.62489 WP_009871802.1.62968 WP_009871802.1.64162 WP_009871802.1.65182 WP_009871802.1.65391 WP_009871802.1.67250 WP_009871802.1.69355 WP_009871802.1.71307 WP_009871802.1.71619 WP_009871802.1.71686 WP_009871802.1.72034 WP_009871802.1.72164 WP_009871802.1.72442 WP_009871802.1.74323 WP_009871802.1.75470 WP_009871802.1.77651 WP_009871802.1.79775 WP_009871802.1.83525 WP_009871802.1.83642 WP_009871802.1.85365 WP_009871802.1.86066 WP_009871802.1.87079 WP_009871802.1.93216 WP_009871802.1.9343 WP_009871802.1.93600 WP_009871802.1.97423 WP_009871802.1.97602 WP_009871802.1.99598 YP_001654778.1.27483 gi|478468009|ref|YP_007742882.1| gi|527326901|ref|YP_008353093.1| gi|385246354|ref|YP_005815176.1| gi|482546761|ref|YP_007852677.1| gi|527325979|ref|YP_008352172.1| gi|478449973|ref|YP_007719530.1| IDP90419 gi|478469818|ref|YP_007723098.1| gi|478452673|ref|YP_007720421.1| gi|478460810|ref|YP_007735761.1| gi|339626124|ref|YP_004717603.1| gi|76789181|ref|YP_328267.1| gi|478471608|ref|YP_007740211.1| gi|478465309|ref|YP_007741991.1| gi|478447283|ref|YP_007715971.1| 272561.CT446 315277.CTA_0487 471472.CTL0706 471473.CTLon_0702 672161.CTB_4481 gi|478451774|ref|YP_007715080.1| gi|568111704|ref|YP_008921309.1| gi|527328753|ref|YP_008354943.1| gi|478470717|ref|YP_007729358.1| gi|478467108|ref|YP_007718640.1| gi|527322017|ref|YP_008348215.1| gi|478463512|ref|YP_007739324.1| gi|15605173|ref|NP_219959.1| gi|478455385|ref|YP_007727575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]