SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452685|ref|YP_007720433.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452685|ref|YP_007720433.1|
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.08e-26
Family N-acetyl transferase, NAT 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452685|ref|YP_007720433.1|
Sequence length 167
Comment putative acetyltransferase YhhY [Chlamydia trachomatis L2b/Canada1]
Sequence
MTTMRDPLLEIRYTVPEDAHYMRLWLNDPKILRGFPLKTEAEIRDSVNFWVSFYRCRSSL
TAVYNGEVAGVATLILNPYVKVAHHSLLSIIVGEKFRNKGVGTALLNNLLHLGKTQLKLE
LVYLEVYEGNPAIHLYERFGFVEVGRQKTFYKDELGYLAKITMERVL
Download sequence
Identical sequences A0A0E9CUW5 A0A0H2X159 A0A0H3MCI3 O84464
gi|527320165|ref|YP_008346365.1| gi|527321083|ref|YP_008347282.1| gi|478450886|ref|YP_007721328.1| gi|478458115|ref|YP_007731300.1| gi|389859030|ref|YP_006361271.1| gi|478464421|ref|YP_007741113.1| gi|527319208|ref|YP_008345409.1| gi|478468021|ref|YP_007742894.1| gi|527318285|ref|YP_008344487.1| gi|385242759|ref|YP_005810598.1| gi|527322974|ref|YP_008349171.1| gi|237802886|ref|YP_002888080.1| gi|385246368|ref|YP_005815190.1| gi|166155547|ref|YP_001653802.1| gi|385239981|ref|YP_005807823.1| gi|478469830|ref|YP_007723110.1| gi|478452685|ref|YP_007720433.1| gi|15605185|ref|NP_219971.1| gi|478455397|ref|YP_007727587.1| gi|76789194|ref|YP_328280.1| gi|478449985|ref|YP_007719542.1| gi|471328634|ref|YP_007540159.1| gi|478448187|ref|YP_007722221.1| NP_219971.1.57406 WP_009871816.1.100466 WP_009871816.1.100644 WP_009871816.1.100883 WP_009871816.1.101362 WP_009871816.1.101735 WP_009871816.1.102133 WP_009871816.1.11148 WP_009871816.1.11717 WP_009871816.1.11732 WP_009871816.1.13674 WP_009871816.1.13766 WP_009871816.1.13837 WP_009871816.1.1409 WP_009871816.1.14786 WP_009871816.1.14984 WP_009871816.1.15381 WP_009871816.1.17082 WP_009871816.1.18643 WP_009871816.1.1923 WP_009871816.1.19304 WP_009871816.1.20022 WP_009871816.1.20093 WP_009871816.1.22210 WP_009871816.1.25195 WP_009871816.1.25246 WP_009871816.1.27753 WP_009871816.1.27980 WP_009871816.1.28239 WP_009871816.1.29171 WP_009871816.1.30792 WP_009871816.1.31373 WP_009871816.1.32156 WP_009871816.1.32801 WP_009871816.1.32856 WP_009871816.1.34934 WP_009871816.1.35043 WP_009871816.1.36244 WP_009871816.1.36518 WP_009871816.1.3661 WP_009871816.1.37417 WP_009871816.1.37673 WP_009871816.1.37956 WP_009871816.1.38181 WP_009871816.1.38504 WP_009871816.1.38794 WP_009871816.1.38813 WP_009871816.1.39258 WP_009871816.1.40272 WP_009871816.1.40464 WP_009871816.1.40808 WP_009871816.1.4187 WP_009871816.1.4264 WP_009871816.1.42718 WP_009871816.1.42889 WP_009871816.1.43504 WP_009871816.1.44223 WP_009871816.1.45552 WP_009871816.1.48551 WP_009871816.1.48923 WP_009871816.1.4939 WP_009871816.1.49465 WP_009871816.1.5036 WP_009871816.1.51159 WP_009871816.1.51530 WP_009871816.1.52091 WP_009871816.1.53299 WP_009871816.1.5416 WP_009871816.1.55117 WP_009871816.1.57520 WP_009871816.1.57533 WP_009871816.1.58046 WP_009871816.1.58308 WP_009871816.1.5967 WP_009871816.1.60427 WP_009871816.1.60937 WP_009871816.1.61004 WP_009871816.1.61683 WP_009871816.1.62239 WP_009871816.1.62489 WP_009871816.1.62510 WP_009871816.1.62968 WP_009871816.1.64162 WP_009871816.1.65391 WP_009871816.1.66489 WP_009871816.1.67104 WP_009871816.1.67250 WP_009871816.1.69355 WP_009871816.1.69519 WP_009871816.1.69991 WP_009871816.1.71307 WP_009871816.1.71619 WP_009871816.1.72034 WP_009871816.1.72164 WP_009871816.1.72442 WP_009871816.1.74323 WP_009871816.1.74635 WP_009871816.1.75470 WP_009871816.1.77153 WP_009871816.1.77651 WP_009871816.1.78375 WP_009871816.1.79775 WP_009871816.1.83525 WP_009871816.1.83642 WP_009871816.1.85256 WP_009871816.1.85365 WP_009871816.1.86066 WP_009871816.1.87079 WP_009871816.1.87298 WP_009871816.1.87666 WP_009871816.1.88177 WP_009871816.1.88937 WP_009871816.1.9107 WP_009871816.1.92427 WP_009871816.1.93216 WP_009871816.1.9343 WP_009871816.1.95142 WP_009871816.1.96955 WP_009871816.1.97423 WP_009871816.1.97602 WP_009871816.1.99598 YP_001654790.1.27483 gi|478473430|ref|YP_007734878.1| gi|478467120|ref|YP_007718652.1| gi|478459918|ref|YP_007733986.1| gi|385240905|ref|YP_005808746.1| gi|478453599|ref|YP_007717761.1| gi|385245443|ref|YP_005814266.1| gi|478475237|ref|YP_007724906.1| gi|166154672|ref|YP_001654790.1| gi|568111716|ref|YP_008921323.1| gi|478461720|ref|YP_007736670.1| gi|527326915|ref|YP_008353107.1| gi|478447295|ref|YP_007715983.1| gi|385241836|ref|YP_005809676.1| gi|527328767|ref|YP_008354957.1| gi|478460822|ref|YP_007735773.1| gi|339626136|ref|YP_004717615.1| gi|478474333|ref|YP_007730409.1| gi|389859906|ref|YP_006362146.1| gi|386262815|ref|YP_005816094.1| gi|527325070|ref|YP_008351264.1| gi|527323935|ref|YP_008350131.1| gi|478470729|ref|YP_007729370.1| gi|478463524|ref|YP_007739336.1| gi|482546775|ref|YP_007852691.1| gi|478462625|ref|YP_007738446.1| gi|478451786|ref|YP_007715092.1| gi|385244546|ref|YP_005812390.1| 272561.CT458 315277.CTA_0500 471472.CTL0718 471473.CTLon_0714 580049.JALI_4601 gi|478456313|ref|YP_007726696.1| gi|527325993|ref|YP_008352186.1| gi|385243666|ref|YP_005811512.1| gi|478465321|ref|YP_007742003.1| gi|478471620|ref|YP_007740223.1| gi|478457206|ref|YP_007725799.1| gi|482545831|ref|YP_007851749.1| gi|478454491|ref|YP_007716870.1| gi|478472528|ref|YP_007733095.1| gi|389858154|ref|YP_006360396.1| gi|527327842|ref|YP_008354033.1| gi|478428595|ref|YP_007541035.1| gi|527322031|ref|YP_008348229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]