SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452690|ref|YP_007720438.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452690|ref|YP_007720438.1|
Domain Number 1 Region: 3-257
Classification Level Classification E-value
Superfamily Pseudouridine synthase 7.77e-83
Family Pseudouridine synthase I TruA 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452690|ref|YP_007720438.1|
Sequence length 267
Comment tRNA pseudouridine synthase A [Chlamydia trachomatis L2b/Canada1]
Sequence
MTKKIVLQIAYQGTSYSGWQYQPNALSIQEVLKTILKKIAGFRISVISSGRTDAGVHAQG
QIAHFHCPDHPHFTDPRQIQKMLNALLPHDIVIRDAVMTDGDFHSRFSAIAKEYRYTLSL
LPKPLPHHRLFCFSPRYKLNIARMQEAAQYLVGTHDFASFANLGREYSSTIRTLYTLDLS
EQEHLVTVICRGNGFLYKMVRNIVGALLDIGKGKYPPEHLLDMLATKDRRKGPPSAPPYG
LSLHHVCYPPPYQWFCKHEHNNSSEGK
Download sequence
Identical sequences A0A0E9DS84 B0B836 B0BCA1
gi|478465326|ref|YP_007742008.1| gi|478464426|ref|YP_007741118.1| gi|482545836|ref|YP_007851754.1| WP_009873831.1.100883 WP_009873831.1.101735 WP_009873831.1.11148 WP_009873831.1.17082 WP_009873831.1.18643 WP_009873831.1.22210 WP_009873831.1.25195 WP_009873831.1.27753 WP_009873831.1.27980 WP_009873831.1.38181 WP_009873831.1.38794 WP_009873831.1.40464 WP_009873831.1.40808 WP_009873831.1.42718 WP_009873831.1.45552 WP_009873831.1.48923 WP_009873831.1.49465 WP_009873831.1.51159 WP_009873831.1.53299 WP_009873831.1.5416 WP_009873831.1.58046 WP_009873831.1.58308 WP_009873831.1.5967 WP_009873831.1.60427 WP_009873831.1.61004 WP_009873831.1.62489 WP_009873831.1.64162 WP_009873831.1.71307 WP_009873831.1.79775 WP_009873831.1.83642 WP_009873831.1.85365 WP_009873831.1.97423 WP_009873831.1.99598 YP_001654795.1.27483 gi|478454496|ref|YP_007716875.1| gi|527327847|ref|YP_008354038.1| gi|527318290|ref|YP_008344492.1| gi|527325998|ref|YP_008352191.1| gi|166154677|ref|YP_001654795.1| gi|478468026|ref|YP_007742899.1| gi|527328772|ref|YP_008354962.1| gi|339626142|ref|YP_004717621.1| gi|478451791|ref|YP_007715097.1| gi|527326920|ref|YP_008353112.1| gi|478452690|ref|YP_007720438.1| gi|482546780|ref|YP_007852696.1| gi|478453604|ref|YP_007717766.1| 471472.CTL0723 471473.CTLon_0719 gi|527323940|ref|YP_008350136.1| gi|166155552|ref|YP_001653807.1| gi|478447300|ref|YP_007715988.1| gi|478471625|ref|YP_007740228.1| gi|478462630|ref|YP_007738451.1| gi|478469835|ref|YP_007723115.1| gi|478449990|ref|YP_007719547.1| gi|478463529|ref|YP_007739341.1| gi|478470734|ref|YP_007729375.1| gi|478467125|ref|YP_007718657.1| gi|478450891|ref|YP_007721333.1| gi|478448192|ref|YP_007722226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]