SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452691|ref|YP_007720439.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452691|ref|YP_007720439.1|
Domain Number 1 Region: 6-200
Classification Level Classification E-value
Superfamily HAD-like 8.73e-31
Family beta-Phosphoglucomutase-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452691|ref|YP_007720439.1|
Sequence length 224
Comment 2-deoxyglucose-6-phosphatase [Chlamydia trachomatis L2b/Canada1]
Sequence
MRLDSYEVYFFDLDGLLIDTEPLFYQACLETWQKYKVSVELSFSQYYSLAMQGRERFQEA
LIQLFPETRAFFPSYFLDRDRCYHDLLSCEQIQLMPGVETFLSLLEGKCLGVVTNSSKES
TLRIRKEHPVLECMQFWITREEYARPKPAPDSYRLAWNRFVREGDHVIGFEDSVKGLQAL
AGIPATMVAINAERSLEQTQSLFPGKEYYYFPSLELLCSCLQNH
Download sequence
Identical sequences A0A0E9CAC5 A0A0H3MDN3
gi|478452691|ref|YP_007720439.1| gi|389859036|ref|YP_006361277.1| gi|478462631|ref|YP_007738452.1| gi|385241842|ref|YP_005809682.1| gi|478461726|ref|YP_007736676.1| gi|389858160|ref|YP_006360402.1| gi|478447301|ref|YP_007715989.1| gi|478449991|ref|YP_007719548.1| gi|339626143|ref|YP_004717622.1| gi|471328640|ref|YP_007540165.1| gi|478463530|ref|YP_007739342.1| gi|478465327|ref|YP_007742009.1| gi|478472534|ref|YP_007733101.1| gi|478464427|ref|YP_007741119.1| gi|527325999|ref|YP_008352192.1| gi|527318291|ref|YP_008344493.1| gi|478454497|ref|YP_007716876.1| gi|166154678|ref|YP_001654796.1| gi|478471626|ref|YP_007740229.1| gi|166155553|ref|YP_001653808.1| gi|478428601|ref|YP_007541041.1| gi|389859912|ref|YP_006362152.1| gi|482546781|ref|YP_007852697.1| gi|478456319|ref|YP_007726702.1| gi|478468027|ref|YP_007742900.1| 471472.CTL0724 471473.CTLon_0720 WP_009872679.1.100466 WP_009872679.1.100883 WP_009872679.1.101735 WP_009872679.1.11148 WP_009872679.1.11717 WP_009872679.1.11732 WP_009872679.1.13766 WP_009872679.1.13837 WP_009872679.1.1409 WP_009872679.1.14786 WP_009872679.1.15381 WP_009872679.1.17082 WP_009872679.1.18643 WP_009872679.1.1923 WP_009872679.1.19304 WP_009872679.1.20022 WP_009872679.1.22210 WP_009872679.1.25195 WP_009872679.1.25246 WP_009872679.1.27753 WP_009872679.1.27980 WP_009872679.1.28239 WP_009872679.1.29171 WP_009872679.1.31373 WP_009872679.1.32156 WP_009872679.1.32856 WP_009872679.1.35043 WP_009872679.1.36244 WP_009872679.1.36518 WP_009872679.1.3661 WP_009872679.1.37417 WP_009872679.1.37673 WP_009872679.1.37956 WP_009872679.1.38181 WP_009872679.1.38794 WP_009872679.1.38813 WP_009872679.1.39258 WP_009872679.1.40272 WP_009872679.1.40464 WP_009872679.1.40808 WP_009872679.1.4187 WP_009872679.1.42718 WP_009872679.1.44223 WP_009872679.1.45552 WP_009872679.1.48551 WP_009872679.1.48923 WP_009872679.1.4939 WP_009872679.1.49465 WP_009872679.1.51159 WP_009872679.1.51530 WP_009872679.1.53299 WP_009872679.1.5416 WP_009872679.1.57520 WP_009872679.1.57533 WP_009872679.1.58046 WP_009872679.1.58308 WP_009872679.1.5967 WP_009872679.1.60427 WP_009872679.1.61004 WP_009872679.1.62489 WP_009872679.1.62510 WP_009872679.1.64162 WP_009872679.1.66489 WP_009872679.1.67104 WP_009872679.1.69519 WP_009872679.1.69991 WP_009872679.1.71307 WP_009872679.1.74635 WP_009872679.1.77153 WP_009872679.1.78375 WP_009872679.1.79775 WP_009872679.1.83642 WP_009872679.1.85256 WP_009872679.1.85365 WP_009872679.1.87298 WP_009872679.1.87666 WP_009872679.1.88177 WP_009872679.1.88937 WP_009872679.1.9107 WP_009872679.1.95142 WP_009872679.1.96955 WP_009872679.1.97423 WP_009872679.1.99598 YP_001654796.1.27483 gi|478470735|ref|YP_007729376.1| gi|478451792|ref|YP_007715098.1| gi|478453605|ref|YP_007717767.1| gi|478448193|ref|YP_007722227.1| gi|478469836|ref|YP_007723116.1| gi|527328773|ref|YP_008354963.1| gi|527325076|ref|YP_008351270.1| gi|482545837|ref|YP_007851755.1| gi|385245449|ref|YP_005814272.1| gi|478474339|ref|YP_007730415.1| gi|527327848|ref|YP_008354039.1| gi|478450892|ref|YP_007721334.1| gi|527319214|ref|YP_008345415.1| gi|386262821|ref|YP_005816100.1| gi|527321089|ref|YP_008347288.1| gi|527323941|ref|YP_008350137.1| gi|527326921|ref|YP_008353113.1| gi|478467126|ref|YP_007718658.1| gi|478473436|ref|YP_007734884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]