SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452693|ref|YP_007720441.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|478452693|ref|YP_007720441.1|
Domain Number - Region: 41-106
Classification Level Classification E-value
Superfamily OmpH-like 0.0235
Family OmpH-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452693|ref|YP_007720441.1|
Sequence length 109
Comment hypothetical protein L2BCAN1_00487 [Chlamydia trachomatis L2b/Canada1]
Sequence
MKESALLPLLKKXKGFFLSILDLTQVEASLSPEDLIKVLRQKKTLLSCIEKVDHQIKKFR
DSFSLALPQEVQEELEEIRSVIQRILETDKKNYCIRKRELGTYAKNRHL
Download sequence
Identical sequences WP_015505825.1.27753 gi|478452693|ref|YP_007720441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]