SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452702|ref|YP_007720450.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452702|ref|YP_007720450.1|
Domain Number 1 Region: 209-395
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.3e-56
Family B3/B4 domain of PheRS, PheT 0.0000302
Further Details:      
 
Domain Number 2 Region: 479-680
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.28e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00053
Further Details:      
 
Domain Number 3 Region: 41-196
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.9e-30
Family Myf domain 0.0025
Further Details:      
 
Domain Number 4 Region: 689-782
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.44e-20
Family Anticodon-binding domain of PheRS 0.0019
Further Details:      
 
Domain Number 5 Region: 409-471
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000201
Family Domains B1 and B5 of PheRS-beta, PheT 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452702|ref|YP_007720450.1|
Sequence length 790
Comment phenylalanyl-tRNA synthetase subunit beta [Chlamydia trachomatis L2b/Canada1]
Sequence
MLVPLSLLQKFFSSPLSIEEILQACDRIGIEAECSNVFPDSLNTVVTGKILSASPHPDAE
RLTVAIVFDGKGKRQIICGAPNCRAGIIVPIALPGAKLRNASGEITTIKKAKIRGLESQG
MCCGADELGFPHLQKAQRGIFEFPADTPLGESACMLLAGASLECSLTPNLGHCASLLGLA
REISFLSPVSLNIPEEFSFASLPQETSICDMHDAGACPVFYSVKISGLSCRRSPEYLQAA
LTALGQKPLNAIVDITNYVMLSLGQPLHAYDSQAVEQKSLHAATLQSAQPLTLLNQETYT
LPAGSLVVADQHNILGLAGVMGSAASSCSENTTEIILEAAYFQPQAVRKYQRTIQLHTEA
AYRFTRGVDPQGVLPALHAAIHMIQSLFPDAQISPIQKIGDDSFFPLSLSVRPKTIKRLL
DIELSTAEIVAKLFSLGFQTAVEEQAVRVEVPSYRHDIQEETDLVEEICRTTPFVQKTQK
ILPTYTPIYSLKRELTAFLANGGLQQFFTCSLLDTEVSSLSLQESSLIPVQNSSWKLRDS
LLPGMLKSAATNLHRQAPYVYAFEIGNVYSKEQNRYQEEERVAILLSRQVMDDSWQGKTP
LSFYTIKGWVEKLLCQSGASIEDFSLQPSQHPNFHPYQQAALYQKKHLLGIFGTLHPQLC
RKAQIKHDVVFAELSLNVLLSLKKKSGPHYVPYPIYPASSRDITITIDRDLPADLVRREL
LSFESKWLESVHIVSVYQGRDSASQSKNVSLRMVFRDHERTLSGQEIEEEYERLTALLDK
KLANIGQGNS
Download sequence
Identical sequences A0A0E9FZ04 A0A0H3MHF2
gi|478469847|ref|YP_007723127.1| gi|166154689|ref|YP_001654807.1| gi|478471637|ref|YP_007740240.1| gi|478452702|ref|YP_007720450.1| gi|478468038|ref|YP_007742911.1| gi|478450002|ref|YP_007719559.1| 471472.CTL0736 471473.CTLon_0731 gi|478467137|ref|YP_007718669.1| gi|478453616|ref|YP_007717778.1| gi|527323952|ref|YP_008350148.1| gi|339626154|ref|YP_004717633.1| gi|527327859|ref|YP_008354050.1| gi|478464438|ref|YP_007741130.1| gi|527326010|ref|YP_008352203.1| gi|482546792|ref|YP_007852708.1| gi|527326932|ref|YP_008353124.1| gi|527318302|ref|YP_008344504.1| gi|482545848|ref|YP_007851766.1| gi|478447312|ref|YP_007716000.1| WP_009873839.1.100883 WP_009873839.1.101735 WP_009873839.1.11148 WP_009873839.1.17082 WP_009873839.1.18643 WP_009873839.1.22210 WP_009873839.1.25195 WP_009873839.1.27753 WP_009873839.1.27980 WP_009873839.1.38794 WP_009873839.1.40464 WP_009873839.1.40808 WP_009873839.1.42718 WP_009873839.1.45552 WP_009873839.1.48923 WP_009873839.1.5416 WP_009873839.1.58046 WP_009873839.1.58308 WP_009873839.1.5967 WP_009873839.1.60427 WP_009873839.1.62489 WP_009873839.1.71307 WP_009873839.1.79775 WP_009873839.1.83642 WP_009873839.1.85365 WP_009873839.1.97423 WP_009873839.1.99598 YP_001654807.1.27483 gi|166155564|ref|YP_001653819.1| gi|478465338|ref|YP_007742020.1| gi|478450903|ref|YP_007721345.1| gi|478454508|ref|YP_007716887.1| gi|478470746|ref|YP_007729387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]