SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452718|ref|YP_007720466.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452718|ref|YP_007720466.1|
Domain Number 1 Region: 22-295,386-402
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.26e-66
Family glucose-1-phosphate thymidylyltransferase 0.00000531
Further Details:      
 
Domain Number 2 Region: 318-440
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 5.65e-17
Family GlmU C-terminal domain-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452718|ref|YP_007720466.1|
Sequence length 441
Comment glucose-1-phosphate adenylyltransferase [Chlamydia trachomatis L2b/Canada1]
Sequence
MAGRRTKEEQINRKRSHFYRDNVGVIVLCGGEGKRLSPLTCWRCKPTVSFGGRYKLIDVP
ISHAFASEFSKIFVIGQYLTYTLQQHLFKTYFYHGVMQDQIHLLVPERRDGSQVWYQGTA
DAIRQNLLYLQDSRVEYFLILSGDQLYNMDFRSIVDYAIDAQADMVIASQPVSDKDVSRF
GVLKVDDESKLIDFYEKPQSEEILKHFRLSNTAMKKFGLDPQHGNFLGSMGIYLFRKDCL
FQLLLEETGDDFGKELIHRQMHRGKTVAYLYDGYWTDIGTIESYYEANMALTQRPSHNIR
GFNCYDDGGIIYSKNNHLPGAIISDSRISSSLLCEGAMIESGQVSNSVVGVRGVIGQGSV
FDRSIMMGSDSYGSESFPLGIGKNCEIHKTIIDENCCIGNGVRLQNLQGHKDYDSPDGKL
VVRDGIIIVPRGTQIPDNYVF
Download sequence
Identical sequences A0A0E9E625 A0A0H3MCK2
gi|478470762|ref|YP_007729403.1| gi|166155578|ref|YP_001653833.1| gi|527323969|ref|YP_008350165.1| gi|478452718|ref|YP_007720466.1| gi|478447328|ref|YP_007716016.1| gi|478450018|ref|YP_007719575.1| gi|527318319|ref|YP_008344521.1| gi|527326949|ref|YP_008353141.1| gi|478467153|ref|YP_007718685.1| gi|478463557|ref|YP_007739369.1| WP_009873850.1.100883 WP_009873850.1.101735 WP_009873850.1.11148 WP_009873850.1.11732 WP_009873850.1.17082 WP_009873850.1.18643 WP_009873850.1.22210 WP_009873850.1.25195 WP_009873850.1.27753 WP_009873850.1.27980 WP_009873850.1.38181 WP_009873850.1.38794 WP_009873850.1.40464 WP_009873850.1.40808 WP_009873850.1.42718 WP_009873850.1.45552 WP_009873850.1.48923 WP_009873850.1.49465 WP_009873850.1.51159 WP_009873850.1.53299 WP_009873850.1.5416 WP_009873850.1.58046 WP_009873850.1.58308 WP_009873850.1.5967 WP_009873850.1.60427 WP_009873850.1.62489 WP_009873850.1.64162 WP_009873850.1.71307 WP_009873850.1.79775 WP_009873850.1.83642 WP_009873850.1.85365 WP_009873850.1.97423 WP_009873850.1.99598 YP_001654821.1.27483 gi|339626171|ref|YP_004717650.1| gi|478462658|ref|YP_007738479.1| gi|527326027|ref|YP_008352220.1| gi|478471653|ref|YP_007740256.1| gi|478453632|ref|YP_007717794.1| 471472.CTL0750 471473.CTLon_0745 gi|482545865|ref|YP_007851783.1| gi|482546809|ref|YP_007852725.1| gi|478465354|ref|YP_007742036.1| gi|478454524|ref|YP_007716903.1| gi|478469863|ref|YP_007723143.1| gi|527327876|ref|YP_008354067.1| gi|478448220|ref|YP_007722254.1| gi|478450919|ref|YP_007721361.1| gi|166154703|ref|YP_001654821.1| gi|478468054|ref|YP_007742927.1| gi|478451819|ref|YP_007715125.1| gi|478464454|ref|YP_007741146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]