SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452736|ref|YP_007720484.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452736|ref|YP_007720484.1|
Domain Number 1 Region: 66-202
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.15e-24
Family Insert subdomain of RNA polymerase alpha subunit 0.00042
Further Details:      
 
Domain Number 2 Region: 32-64,203-256
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.18e-22
Family RNA polymerase alpha subunit dimerisation domain 0.0032
Further Details:      
 
Domain Number 3 Region: 280-353
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 3.27e-22
Family C-terminal domain of RNA polymerase alpha subunit 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452736|ref|YP_007720484.1|
Sequence length 377
Comment DNA-directed RNA polymerase subunit alpha [Chlamydia trachomatis L2b/Canada1]
Sequence
MSDSSHNLLYNKFELPESVKMSPVEGAVGGIDKVARFVADPLEKGMGHTLGSALRRALLI
GLEAPAIVSFSMTGVLHEYMAVEGIIEDVTNIVLNLKGSLLKKYPLQDCEGGRCSQKLRA
TISVDASDLAAAGGQKEVTLGDLLQEGTFEAVNPEHVIFTVTRPMQLEVMLRVAFGRGYS
PSERIVLEERGMNEIVLDAAFSPVVLVNYFVEDTRVGQDTDFDRLVLQVETDGRVAPKEA
VAFATQILSKHFSVFEKMDEKRIVFEEAISVEKENKDDILHKLVLGINEIELSVRSTNCL
SNANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLKEMKLELGMDLSQFGVGLDNVKE
KMKWYAEKIRSSKNTKG
Download sequence
Identical sequences A0A0E9E5Z3 B0B881 B0BCE6
gi|478451837|ref|YP_007715143.1| gi|527327895|ref|YP_008354086.1| gi|527318339|ref|YP_008344541.1| gi|478471671|ref|YP_007740274.1| gi|527326047|ref|YP_008352240.1| gi|478470780|ref|YP_007729421.1| gi|527328822|ref|YP_008355012.1| gi|478468072|ref|YP_007742945.1| gi|527323988|ref|YP_008350184.1| gi|482545885|ref|YP_007851803.1| gi|478453650|ref|YP_007717812.1| gi|478465372|ref|YP_007742054.1| 471472.CTL0769 471473.CTLon_0764 gi|478464472|ref|YP_007741164.1| gi|478454542|ref|YP_007716921.1| gi|478448238|ref|YP_007722272.1| gi|478463575|ref|YP_007739387.1| gi|478452736|ref|YP_007720484.1| WP_009873864.1.100883 WP_009873864.1.101735 WP_009873864.1.11148 WP_009873864.1.11732 WP_009873864.1.17082 WP_009873864.1.18643 WP_009873864.1.22210 WP_009873864.1.25195 WP_009873864.1.27753 WP_009873864.1.27980 WP_009873864.1.38181 WP_009873864.1.38794 WP_009873864.1.40464 WP_009873864.1.40808 WP_009873864.1.42718 WP_009873864.1.45552 WP_009873864.1.48923 WP_009873864.1.49465 WP_009873864.1.51159 WP_009873864.1.53299 WP_009873864.1.5416 WP_009873864.1.58046 WP_009873864.1.58308 WP_009873864.1.5967 WP_009873864.1.60427 WP_009873864.1.61004 WP_009873864.1.62489 WP_009873864.1.64162 WP_009873864.1.71307 WP_009873864.1.79775 WP_009873864.1.83642 WP_009873864.1.85365 WP_009873864.1.97423 WP_009873864.1.99598 YP_001654840.1.27483 gi|166155597|ref|YP_001653852.1| gi|478450036|ref|YP_007719593.1| gi|478467171|ref|YP_007718703.1| gi|478462676|ref|YP_007738497.1| gi|166154722|ref|YP_001654840.1| gi|478450937|ref|YP_007721379.1| gi|478469881|ref|YP_007723161.1| gi|482546828|ref|YP_007852744.1| gi|478447346|ref|YP_007716034.1| gi|527326969|ref|YP_008353161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]