SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452746|ref|YP_007720494.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452746|ref|YP_007720494.1|
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 5.64e-23
Family Ribosomal proteins L24p and L21e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452746|ref|YP_007720494.1|
Sequence length 111
Comment 50S ribosomal protein L24 [Chlamydia trachomatis L2b/Canada1]
Sequence
MKRRSVCVGDTVYVLAGNDKGKQGKVLRCLKDKVVVEGINVRVKNIKRSQENPKGKRINI
EAPLHISNVRLSIDNQPARLFVKVTEKGRELWNKHSDGSSSLYRLVRERKG
Download sequence
Identical sequences A0A069ZZ87 A0A0E9C6V5 B0B891 B0BCF6 Q9PJM5
243161.TC0804 471472.CTL0779 471473.CTLon_0774 gi|478474393|ref|YP_007730469.1| gi|471328693|ref|YP_007540218.1| gi|478462686|ref|YP_007738507.1| gi|478447356|ref|YP_007716044.1| gi|385241899|ref|YP_005809739.1| gi|478467181|ref|YP_007718713.1| gi|478465382|ref|YP_007742064.1| gi|478454552|ref|YP_007716931.1| gi|527318349|ref|YP_008344551.1| gi|478471681|ref|YP_007740284.1| gi|478468082|ref|YP_007742955.1| gi|478450046|ref|YP_007719603.1| gi|478452746|ref|YP_007720494.1| WP_009872719.1.100466 WP_009872719.1.100883 WP_009872719.1.101735 WP_009872719.1.11148 WP_009872719.1.11717 WP_009872719.1.11732 WP_009872719.1.13766 WP_009872719.1.13837 WP_009872719.1.1409 WP_009872719.1.14786 WP_009872719.1.15381 WP_009872719.1.17082 WP_009872719.1.18643 WP_009872719.1.18971 WP_009872719.1.1923 WP_009872719.1.19304 WP_009872719.1.19393 WP_009872719.1.20022 WP_009872719.1.21797 WP_009872719.1.22210 WP_009872719.1.25195 WP_009872719.1.25246 WP_009872719.1.27753 WP_009872719.1.27980 WP_009872719.1.28239 WP_009872719.1.29171 WP_009872719.1.31373 WP_009872719.1.32156 WP_009872719.1.32856 WP_009872719.1.35043 WP_009872719.1.36244 WP_009872719.1.36518 WP_009872719.1.3661 WP_009872719.1.37417 WP_009872719.1.37673 WP_009872719.1.37956 WP_009872719.1.38794 WP_009872719.1.38813 WP_009872719.1.39258 WP_009872719.1.40272 WP_009872719.1.40339 WP_009872719.1.40464 WP_009872719.1.40808 WP_009872719.1.40903 WP_009872719.1.4187 WP_009872719.1.42718 WP_009872719.1.45552 WP_009872719.1.45721 WP_009872719.1.46238 WP_009872719.1.48551 WP_009872719.1.48923 WP_009872719.1.4939 WP_009872719.1.49465 WP_009872719.1.51159 WP_009872719.1.51530 WP_009872719.1.53299 WP_009872719.1.5416 WP_009872719.1.57520 WP_009872719.1.57533 WP_009872719.1.58046 WP_009872719.1.58308 WP_009872719.1.5967 WP_009872719.1.60427 WP_009872719.1.60880 WP_009872719.1.61004 WP_009872719.1.62489 WP_009872719.1.62510 WP_009872719.1.63773 WP_009872719.1.64162 WP_009872719.1.66489 WP_009872719.1.67104 WP_009872719.1.69188 WP_009872719.1.69519 WP_009872719.1.69991 WP_009872719.1.71307 WP_009872719.1.74635 WP_009872719.1.77153 WP_009872719.1.77803 WP_009872719.1.78375 WP_009872719.1.79775 WP_009872719.1.83642 WP_009872719.1.85209 WP_009872719.1.85256 WP_009872719.1.85365 WP_009872719.1.87298 WP_009872719.1.87666 WP_009872719.1.88177 WP_009872719.1.88937 WP_009872719.1.89087 WP_009872719.1.9107 WP_009872719.1.91588 WP_009872719.1.95142 WP_009872719.1.96955 WP_009872719.1.97423 WP_009872719.1.99598 YP_001654850.1.27483 gi|389859089|ref|YP_006361330.1| gi|527323998|ref|YP_008350194.1| gi|166155607|ref|YP_001653862.1| gi|527321147|ref|YP_008347346.1| gi|478456373|ref|YP_007726756.1| gi|478453660|ref|YP_007717822.1| gi|166154732|ref|YP_001654850.1| gi|478450947|ref|YP_007721389.1| gi|478472588|ref|YP_007733155.1| gi|15835418|ref|NP_297177.1| gi|527326979|ref|YP_008353171.1| gi|389858213|ref|YP_006360455.1| gi|478428654|ref|YP_007541094.1| gi|478473490|ref|YP_007734938.1| gi|527326057|ref|YP_008352250.1| gi|478469891|ref|YP_007723171.1| gi|527325133|ref|YP_008351327.1| gi|478451847|ref|YP_007715153.1| gi|478463585|ref|YP_007739397.1| gi|482546838|ref|YP_007852754.1| gi|478461780|ref|YP_007736730.1| gi|482545895|ref|YP_007851813.1| gi|527327905|ref|YP_008354096.1| gi|527319272|ref|YP_008345473.1| gi|478470790|ref|YP_007729431.1| gi|478448248|ref|YP_007722282.1| gi|527328832|ref|YP_008355022.1| gi|389859965|ref|YP_006362205.1| gi|386262874|ref|YP_005816153.1| gi|478464482|ref|YP_007741174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]