SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452749|ref|YP_007720497.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452749|ref|YP_007720497.1|
Domain Number 1 Region: 9-67
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.00000000000275
Family Ribosomal protein L29 (L29p) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452749|ref|YP_007720497.1|
Sequence length 72
Comment 50S ribosomal protein L29 [Chlamydia trachomatis L2b/Canada1]
Sequence
MGAKKNLLAELREKSSEELDEFIRDNKKALFALRAEAALQNKVVKTHQFSLYKKSIARAL
IIKQEKKDRVHG
Download sequence
Identical sequences A0A0E9E7M5 B0B894 B0BCF9
gi|478450950|ref|YP_007721392.1| gi|478470793|ref|YP_007729434.1| gi|527328835|ref|YP_008355025.1| gi|166155610|ref|YP_001653865.1| gi|527326982|ref|YP_008353174.1| gi|478453663|ref|YP_007717825.1| gi|478447359|ref|YP_007716047.1| gi|478464485|ref|YP_007741177.1| gi|478450049|ref|YP_007719606.1| gi|482545898|ref|YP_007851816.1| gi|478469894|ref|YP_007723174.1| gi|478465385|ref|YP_007742067.1| 471472.CTL0782 471473.CTLon_0777 gi|478451850|ref|YP_007715156.1| gi|482546841|ref|YP_007852757.1| gi|527318352|ref|YP_008344554.1| WP_009873872.1.100883 WP_009873872.1.101735 WP_009873872.1.11148 WP_009873872.1.11732 WP_009873872.1.17082 WP_009873872.1.18643 WP_009873872.1.22210 WP_009873872.1.25195 WP_009873872.1.27753 WP_009873872.1.27980 WP_009873872.1.38181 WP_009873872.1.38794 WP_009873872.1.40464 WP_009873872.1.40808 WP_009873872.1.42718 WP_009873872.1.45552 WP_009873872.1.48923 WP_009873872.1.49465 WP_009873872.1.51159 WP_009873872.1.53299 WP_009873872.1.5416 WP_009873872.1.58046 WP_009873872.1.58308 WP_009873872.1.5967 WP_009873872.1.60427 WP_009873872.1.61004 WP_009873872.1.62489 WP_009873872.1.64162 WP_009873872.1.71307 WP_009873872.1.79775 WP_009873872.1.83642 WP_009873872.1.85365 WP_009873872.1.97423 WP_009873872.1.99598 YP_001654853.1.27483 gi|339626204|ref|YP_004717683.1| gi|166154735|ref|YP_001654853.1| gi|478471684|ref|YP_007740287.1| gi|478448251|ref|YP_007722285.1| gi|478454555|ref|YP_007716934.1| gi|527327908|ref|YP_008354099.1| gi|478468085|ref|YP_007742958.1| gi|527324001|ref|YP_008350197.1| gi|527326060|ref|YP_008352253.1| gi|478462689|ref|YP_007738510.1| gi|478463588|ref|YP_007739400.1| gi|478467184|ref|YP_007718716.1| gi|478452749|ref|YP_007720497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]