SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452754|ref|YP_007720502.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452754|ref|YP_007720502.1|
Domain Number 1 Region: 138-279
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.63e-56
Family C-terminal domain of ribosomal protein L2 0.00000528
Further Details:      
 
Domain Number 2 Region: 2-135
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.2e-41
Family Cold shock DNA-binding domain-like 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452754|ref|YP_007720502.1|
Sequence length 284
Comment 50S ribosomal protein L2 [Chlamydia trachomatis L2b/Canada1]
Sequence
MFKKFKPVTPGTRQLILPSFDELTTQGELKGSSSRRSVRPNKKLSFFKKSSGGRDNLGHI
SCRHRGGGVRRHYRVIDFKRNKDGIEAKVASVEYDPNRSAYIALLNYVDGEKRYILAPKG
IKRGDRVISGEGSPFKTGCCMTLKSIPLGLSVHNVEMRPGSGGKLVRSAGLSAQIIAKTA
GYVTLKMPSGEFRMLNEMCRATVGEVSNADHNLCVDGKAGRRRWKGIRPTVRGTAMNPVD
HPHGGGEGRHNGYISQTPWGKVTKGLKTRDKRKSNKWIVKDRRK
Download sequence
Identical sequences A0A0E9AXH1 B0B899 B0BCG4 G4NPE2 O84530 Q3KLH2
gi|385240053|ref|YP_005807895.1| gi|478465390|ref|YP_007742072.1| gi|385242831|ref|YP_005810670.1| 272561.CT525 315277.CTA_0574 471472.CTL0787 471473.CTLon_0782 580049.JALI_5281 672161.CTB_5281 gi|527326987|ref|YP_008353179.1| gi|478450054|ref|YP_007719611.1| gi|478459087|ref|YP_007732271.1| gi|527318357|ref|YP_008344559.1| gi|478463593|ref|YP_007739405.1| gi|478455466|ref|YP_007727656.1| gi|478458184|ref|YP_007731369.1| gi|478470798|ref|YP_007729439.1| gi|237802954|ref|YP_002888148.1| NP_220040.1.57406 WP_009871889.1.100644 WP_009871889.1.100883 WP_009871889.1.101362 WP_009871889.1.101735 WP_009871889.1.102133 WP_009871889.1.11148 WP_009871889.1.11732 WP_009871889.1.13674 WP_009871889.1.13766 WP_009871889.1.14984 WP_009871889.1.17082 WP_009871889.1.17422 WP_009871889.1.18643 WP_009871889.1.20093 WP_009871889.1.22210 WP_009871889.1.25195 WP_009871889.1.27753 WP_009871889.1.27980 WP_009871889.1.30792 WP_009871889.1.31128 WP_009871889.1.32801 WP_009871889.1.34934 WP_009871889.1.38181 WP_009871889.1.38504 WP_009871889.1.38794 WP_009871889.1.40464 WP_009871889.1.40808 WP_009871889.1.4264 WP_009871889.1.42718 WP_009871889.1.42889 WP_009871889.1.43504 WP_009871889.1.45552 WP_009871889.1.48923 WP_009871889.1.49465 WP_009871889.1.5036 WP_009871889.1.51159 WP_009871889.1.52091 WP_009871889.1.5416 WP_009871889.1.55117 WP_009871889.1.58046 WP_009871889.1.58308 WP_009871889.1.5967 WP_009871889.1.60427 WP_009871889.1.60937 WP_009871889.1.61004 WP_009871889.1.6151 WP_009871889.1.61683 WP_009871889.1.62239 WP_009871889.1.62489 WP_009871889.1.62968 WP_009871889.1.64162 WP_009871889.1.65182 WP_009871889.1.65391 WP_009871889.1.67250 WP_009871889.1.69355 WP_009871889.1.71307 WP_009871889.1.71619 WP_009871889.1.71686 WP_009871889.1.72034 WP_009871889.1.72164 WP_009871889.1.72442 WP_009871889.1.74323 WP_009871889.1.75470 WP_009871889.1.77651 WP_009871889.1.79775 WP_009871889.1.83525 WP_009871889.1.83642 WP_009871889.1.85365 WP_009871889.1.86066 WP_009871889.1.87079 WP_009871889.1.92427 WP_009871889.1.93216 WP_009871889.1.9343 WP_009871889.1.93600 WP_009871889.1.97423 WP_009871889.1.97602 WP_009871889.1.99598 YP_001654858.1.27483 gi|527320237|ref|YP_008346437.1| gi|385270227|ref|YP_005813387.1| gi|478462694|ref|YP_007738515.1| gi|478468090|ref|YP_007742963.1| gi|527323048|ref|YP_008349245.1| gi|385270227|ref|YP_005813387.1| gi|478457274|ref|YP_007725867.1| gi|237804876|ref|YP_002889030.1| gi|385244612|ref|YP_005812456.1| gi|478452754|ref|YP_007720502.1| gi|527326065|ref|YP_008352258.1| gi|478453668|ref|YP_007717830.1| gi|478447364|ref|YP_007716052.1| gi|527328840|ref|YP_008355030.1| gi|478451855|ref|YP_007715161.1| gi|478450955|ref|YP_007721397.1| gi|478449159|ref|YP_007724082.1| gi|478460891|ref|YP_007735842.1| gi|568111787|ref|YP_008921394.1| gi|482545903|ref|YP_007851821.1| gi|385243732|ref|YP_005811578.1| gi|15605254|ref|NP_220040.1| gi|385246440|ref|YP_005815262.1| gi|76789262|ref|YP_328348.1| gi|478475306|ref|YP_007724975.1| gi|478464490|ref|YP_007741182.1| gi|482546846|ref|YP_007852762.1| gi|478454560|ref|YP_007716939.1| gi|339626209|ref|YP_004717688.1| gi|478469899|ref|YP_007723179.1| gi|478467189|ref|YP_007718721.1| gi|478471689|ref|YP_007740292.1| gi|385240978|ref|YP_005808819.1| gi|527327913|ref|YP_008354104.1| gi|166154740|ref|YP_001654858.1| gi|478459987|ref|YP_007734055.1| gi|527322103|ref|YP_008348301.1| gi|166155615|ref|YP_001653870.1| gi|527324006|ref|YP_008350202.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]