SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452817|ref|YP_007720565.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452817|ref|YP_007720565.1|
Domain Number 1 Region: 438-643
Classification Level Classification E-value
Superfamily PP2C-like 0.000000000327
Family PP2C-like 0.015
Further Details:      
 
Weak hits

Sequence:  gi|478452817|ref|YP_007720565.1|
Domain Number - Region: 337-385
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0549
Family HAMP domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452817|ref|YP_007720565.1|
Sequence length 650
Comment Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Chlamydia trachomatis L2b/Canada1]
Sequence
MTIPIHENKYSMISFTRTIGFRLWLICVAAIMFPLGINILQLNLQQYKKTLSSITSDLRE
NALFKAHTLQQTIPLNIDILALFSEIFDLDRGVPAEPDLALSKEMEKIFHSTYKEISLVK
KEADGNFRVVASSRIEQLGKNYNQEIFLSDSQPFLATLRHSGSDSQVLAVLQTNIFDISS
QEVLGVLYTLSDTNYLLNGLLAAKDPLSVKTAILSKNGIILQATDSSLDLVSIHKTVSKE
QFCDVFLRDDICPPHLLLRPPLNLDPLPYGENFVSFCIGNTEMWGYIHSLPEMDFRILTY
EEKSIIFASLWRRTLLYFAYFCCVLLGSITAFLVAKRLSKPIRKLATAMMETRRNQHHPY
EPDSLGFEINHLGEIFNSMVQSLSQQQSLAEKNFEIKQHAQNALRLGEEAQQRLLPNQLP
DSATTEIAKAYIPAITVGGDFFDIFVIGEGPQAKLFLIVADASGKGVNACAYSLFLKNML
HTFLSELSSIQEAVQQTAALFYQQTAESGMFVTLCIYCYHYATRELEYYSCGHNPACLRA
PNGDISFLSHPGMALGFLPEVPPHPAYTLVLEEESLLVLYTDGVTEASNKHGEMFGEERL
KALVASLTKQSAEEAIQSIMFSIKSFVKDCPQHDDITLLVLKIPKEPSAY
Download sequence
Identical sequences A0A0E9DTB0
WP_012263667.1.101735 WP_012263667.1.18643 WP_012263667.1.25195 WP_012263667.1.27753 WP_012263667.1.38794 WP_012263667.1.40464 WP_012263667.1.42718 WP_012263667.1.45552 WP_012263667.1.49465 WP_012263667.1.51159 WP_012263667.1.53299 WP_012263667.1.5416 WP_012263667.1.58308 WP_012263667.1.64162 WP_012263667.1.79775 WP_012263667.1.97423 gi|478462757|ref|YP_007738578.1| gi|166155678|ref|YP_001653933.1| gi|478467252|ref|YP_007718784.1| 471473.CTLon_0845 gi|478454623|ref|YP_007717002.1| gi|478470861|ref|YP_007729502.1| gi|478451918|ref|YP_007715224.1| gi|478450117|ref|YP_007719674.1| gi|478451018|ref|YP_007721460.1| gi|478469962|ref|YP_007723242.1| gi|478465453|ref|YP_007742135.1| gi|478463656|ref|YP_007739468.1| gi|478453731|ref|YP_007717893.1| gi|478448319|ref|YP_007722353.1| gi|478468153|ref|YP_007743026.1| gi|478452817|ref|YP_007720565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]