SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452836|ref|YP_007720584.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452836|ref|YP_007720584.1|
Domain Number 1 Region: 1-194
Classification Level Classification E-value
Superfamily ITPase-like 1.15e-54
Family ITPase (Ham1) 0.0000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452836|ref|YP_007720584.1|
Sequence length 209
Comment dITP/XTP pyrophosphatase [Chlamydia trachomatis L2b/Canada1]
Sequence
MKILIASSHGYKVRETKAFLKKLGEFDIFSLVDYPSYQPPKETGETPEENAIQKGLFAAQ
TFRCWTIADDSMLIIPALGGLPGKLSASFAGEQANDKDHRKKLLENMRLLENTIDRSAYF
ECCVALISPFGKIFKAHASCEGTIAFEERGSSGFGYDPLFVKHDYKQTYAELPEAIKNQV
SHRAKALVKLQPYVETVLANHLLAGKESL
Download sequence
Identical sequences A0A0E9E6U9 B0B8I0 B0BA59
gi|527327071|ref|YP_008353263.1| gi|478447446|ref|YP_007716134.1| gi|527328924|ref|YP_008355114.1| gi|478470880|ref|YP_007729521.1| gi|478468172|ref|YP_007743045.1| gi|478454642|ref|YP_007717021.1| gi|478451937|ref|YP_007715243.1| WP_009873939.1.100883 WP_009873939.1.101735 WP_009873939.1.11148 WP_009873939.1.11732 WP_009873939.1.17082 WP_009873939.1.18643 WP_009873939.1.22210 WP_009873939.1.25195 WP_009873939.1.27753 WP_009873939.1.27980 WP_009873939.1.38181 WP_009873939.1.38794 WP_009873939.1.40464 WP_009873939.1.40808 WP_009873939.1.42718 WP_009873939.1.45552 WP_009873939.1.48923 WP_009873939.1.49465 WP_009873939.1.51159 WP_009873939.1.53299 WP_009873939.1.5416 WP_009873939.1.58046 WP_009873939.1.58308 WP_009873939.1.5967 WP_009873939.1.60427 WP_009873939.1.61004 WP_009873939.1.62489 WP_009873939.1.64162 WP_009873939.1.71307 WP_009873939.1.79775 WP_009873939.1.83642 WP_009873939.1.85365 WP_009873939.1.97423 WP_009873939.1.99598 YP_001654938.1.27483 gi|478464572|ref|YP_007741264.1| gi|478462776|ref|YP_007738597.1| gi|478448338|ref|YP_007722372.1| gi|478469981|ref|YP_007723261.1| gi|166155695|ref|YP_001653950.1| gi|478453750|ref|YP_007717912.1| gi|527324090|ref|YP_008350286.1| gi|478451037|ref|YP_007721479.1| gi|478452836|ref|YP_007720584.1| gi|527318441|ref|YP_008344643.1| gi|482546933|ref|YP_007852849.1| 471472.CTL0869 471473.CTLon_0863 gi|478467271|ref|YP_007718803.1| gi|339626297|ref|YP_004717776.1| gi|482545990|ref|YP_007851908.1| gi|478471771|ref|YP_007740374.1| gi|166154820|ref|YP_001654938.1| gi|478465472|ref|YP_007742154.1| gi|527327997|ref|YP_008354188.1| gi|527326149|ref|YP_008352342.1| gi|478450136|ref|YP_007719693.1| gi|478463675|ref|YP_007739487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]