SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452844|ref|YP_007720592.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452844|ref|YP_007720592.1|
Domain Number 1 Region: 176-444
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 2.88e-59
Family Dihydropteroate synthetase 0.0000602
Further Details:      
 
Domain Number 2 Region: 4-151
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 5.89e-32
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452844|ref|YP_007720592.1|
Sequence length 450
Comment dihydropteroate synthase [Chlamydia trachomatis L2b/Canada1]
Sequence
MTSWNFVCLSLGSNLGNRHEHIRRAYASLKKAGIRNLKSSVILETKALLLEGAPKEWDLP
YFNSVVIGETQLSPDELIEEIKMIESRFGQDASLKWGPRPIDIDVLFYGDEAFSYHSDKC
TIPHPKVLERPFILSMMASLCPYRRFRLEGSSCNGKTFAELAAIYPLTEEEALGSFGSAT
QIMGIVNITDNSISDTGLFLEASRAAAHAERLFAEGASIIDLGAQATNPRVKDLGSVEQE
WERLEPVLRLLAERWGAAQQCPDVSIDTFRPEIIRRAVEVFPIRWINDVSGGSLEMAHLA
KEFGLRLLINHSCSLPPRPDCVLSYEESPIEQMLRWGESQLEQFAQVGLDTSWQVVFDPG
IGFGKTPVQSMLLMDGVKQFKRVLECPVLIGHSRKSCLSMLGRFNSDDRDWETIGCSVSL
HDRGVDYLRVHQVEGNRRALAAAAWAGMFV
Download sequence
Identical sequences A0A0E9E6N5
gi|478451045|ref|YP_007721487.1| gi|478453758|ref|YP_007717920.1| gi|478471779|ref|YP_007740382.1| gi|478452844|ref|YP_007720592.1| gi|166155703|ref|YP_001653958.1| gi|478469989|ref|YP_007723269.1| 471473.CTLon_0871 gi|478464580|ref|YP_007741272.1| gi|478468180|ref|YP_007743053.1| gi|478450144|ref|YP_007719701.1| gi|478467279|ref|YP_007718811.1| gi|478454650|ref|YP_007717029.1| WP_012263671.1.101735 WP_012263671.1.18643 WP_012263671.1.25195 WP_012263671.1.27753 WP_012263671.1.38794 WP_012263671.1.40464 WP_012263671.1.42718 WP_012263671.1.45552 WP_012263671.1.48923 WP_012263671.1.5416 WP_012263671.1.58308 WP_012263671.1.5967 WP_012263671.1.79775 WP_012263671.1.97423 gi|478465480|ref|YP_007742162.1| gi|478470888|ref|YP_007729529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]