SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452891|ref|YP_007720639.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452891|ref|YP_007720639.1|
Domain Number 1 Region: 81-314
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.7e-65
Family Pseudouridine synthase RsuA/RluD 0.0000101
Further Details:      
 
Domain Number 2 Region: 20-109
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.000000000805
Family Ribosomal protein S4 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452891|ref|YP_007720639.1|
Sequence length 335
Comment 23S rRNA pseudouridine synthase D [Chlamydia trachomatis L2b/Canada1]
Sequence
MILEIPAPTAVFSFVIDEQLTGRLDKGLVSYNGAYSRAFYQQQIELGRVRVNGRVYTRVS
HPLSLGDVVEVELIEEEEPSSLIPEDIPLDKVYEDDMILVINKPRDMVVHPAPGHTQGTV
VHALLHEIGERLKQEFPEEPWRPGIVHRLDKDTSGLLITVKTRRAKALYSELFATKQVKK
LYVAICINAPSQELIHTRITRHPLKRKEMTVLSTHAEGGKEAITHCHVLATNGRLSVVAL
YPETGRTHQLRVHMKHLGTPILGDPVYGIPSINFRYGLDKQQLHAYSLVFAHPESAERVK
LVTKLPDDMTSLIEKEFREGVSILDGSCDWFKITR
Download sequence
Identical sequences A0A0E9AYV8 A0A0H3MG47
471472.CTL0027 471473.CTLon_0027 gi|527327129|ref|YP_008353321.1| gi|478451991|ref|YP_007715297.1| gi|478447500|ref|YP_007716188.1| gi|478462830|ref|YP_007738651.1| gi|478451091|ref|YP_007721533.1| gi|478471825|ref|YP_007740428.1| gi|527324148|ref|YP_008350344.1| gi|482546057|ref|YP_007851973.1| gi|478454696|ref|YP_007717075.1| gi|478470035|ref|YP_007723315.1| gi|478463729|ref|YP_007739541.1| gi|478464626|ref|YP_007741318.1| gi|478465526|ref|YP_007742208.1| gi|478470934|ref|YP_007729575.1| gi|478452891|ref|YP_007720639.1| WP_009873274.1.100883 WP_009873274.1.101735 WP_009873274.1.11148 WP_009873274.1.11732 WP_009873274.1.17082 WP_009873274.1.18643 WP_009873274.1.22210 WP_009873274.1.25195 WP_009873274.1.27753 WP_009873274.1.38181 WP_009873274.1.38794 WP_009873274.1.40464 WP_009873274.1.40808 WP_009873274.1.42718 WP_009873274.1.45552 WP_009873274.1.48923 WP_009873274.1.49465 WP_009873274.1.51159 WP_009873274.1.53299 WP_009873274.1.5416 WP_009873274.1.58046 WP_009873274.1.58308 WP_009873274.1.5967 WP_009873274.1.62489 WP_009873274.1.64162 WP_009873274.1.71307 WP_009873274.1.79775 WP_009873274.1.83642 WP_009873274.1.85365 WP_009873274.1.97423 WP_009873274.1.99598 YP_001654118.1.27483 gi|166154000|ref|YP_001654118.1| gi|478467325|ref|YP_007718857.1| gi|482545115|ref|YP_007851033.1| gi|478468226|ref|YP_007743099.1| gi|478448392|ref|YP_007722426.1| gi|527318498|ref|YP_008344700.1| gi|478450190|ref|YP_007719747.1| gi|166154875|ref|YP_001653130.1| gi|478453804|ref|YP_007717966.1| gi|339625402|ref|YP_004716881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]