SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452949|ref|YP_007720697.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452949|ref|YP_007720697.1|
Domain Number 1 Region: 9-442
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.39e-117
Family UDP-glucose pyrophosphorylase 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452949|ref|YP_007720697.1|
Sequence length 455
Comment UTP--glucose-1-phosphate uridylyltransferase [Chlamydia trachomatis L2b/Canada1]
Sequence
MTDSSYVDLSFLLDQLLPIQQEHLLEYWPSLSPQQRLRLGTQIAQIDIPFFLRQQALLQN
PQASHQEYTPLSPVHYAGDNPAYAQLGFQLLQRGKVGCVVLAGGQGSRLKFDGPKGLYPV
SSVKKKPLYQLVAEKVAAASKWVGRPLPLAIMTSPLNHKQTLSYFATNDYFNLSPSQVDF
FCQPLWPLLSLSGDLFLESEDRLSLGPTGNGCLSTLLQSSGIWDKWHQAGIEMVSVIPID
NPLALPFDRELVGFHAAEHNDVTIKTTLRQSAQEDVGVLIELAKQKIAVVEYSTLTTKER
CAKTTEGDLTYKLANIGLYCLSMDFLAQTAYQPLPLYKANKHAKQLHPSTTEKNAWKFEE
FIFDLFQYSEHSQAIVYPRHECFAPLKNYEGNHSPATVREAMRKREHALFTAVTERKLSP
NTIFELEADFYYPSSHTSLEWETKIFFQETIIEAS
Download sequence
Identical sequences A0A0E9EFS2 A0A0H3MG79
gi|527327189|ref|YP_008353381.1| gi|478448450|ref|YP_007722484.1| gi|478465584|ref|YP_007742266.1| gi|478452949|ref|YP_007720697.1| gi|478450248|ref|YP_007719805.1| gi|478470992|ref|YP_007729633.1| gi|478467383|ref|YP_007718915.1| gi|166154932|ref|YP_001653187.1| gi|478453862|ref|YP_007718024.1| gi|478451149|ref|YP_007721591.1| gi|478463786|ref|YP_007739598.1| gi|478452049|ref|YP_007715355.1| gi|478447557|ref|YP_007716245.1| gi|478471883|ref|YP_007740486.1| gi|478462888|ref|YP_007738709.1| gi|478464684|ref|YP_007741376.1| gi|478468283|ref|YP_007743156.1| gi|527318558|ref|YP_008344760.1| gi|527328114|ref|YP_008354305.1| WP_009873318.1.100883 WP_009873318.1.101735 WP_009873318.1.11148 WP_009873318.1.17082 WP_009873318.1.18643 WP_009873318.1.22210 WP_009873318.1.25195 WP_009873318.1.27753 WP_009873318.1.38181 WP_009873318.1.38794 WP_009873318.1.40464 WP_009873318.1.42718 WP_009873318.1.45552 WP_009873318.1.48923 WP_009873318.1.49465 WP_009873318.1.51159 WP_009873318.1.53299 WP_009873318.1.5416 WP_009873318.1.58046 WP_009873318.1.58308 WP_009873318.1.5967 WP_009873318.1.60427 WP_009873318.1.61004 WP_009873318.1.62489 WP_009873318.1.64162 WP_009873318.1.71307 WP_009873318.1.79775 WP_009873318.1.83642 WP_009873318.1.97423 WP_009873318.1.99598 YP_001654175.1.27483 gi|478470092|ref|YP_007723372.1| gi|527324208|ref|YP_008350404.1| gi|527329040|ref|YP_008355230.1| 471472.CTL0084 471473.CTLon_0084 gi|166154057|ref|YP_001654175.1| gi|478454754|ref|YP_007717133.1| gi|482545174|ref|YP_007851092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]