SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452957|ref|YP_007720705.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452957|ref|YP_007720705.1|
Domain Number 1 Region: 61-228
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.52e-37
Family Pseudouridine synthase RsuA/RluD 0.0002
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000000012
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452957|ref|YP_007720705.1|
Sequence length 241
Comment 23S rRNA pseudouridine synthase F [Chlamydia trachomatis L2b/Canada1]
Sequence
MAKVRLNKFLASAGVASRRKCDEIIFAGSVTVNGRAATGPFVTVDEEFDSVEVGGQRIGA
EKKVYFMVHKPLGYLCSSERKFPGSKLVIDLLSHCPYRLFTVGRLDKETSGLILVTNDGE
FANRVIHPSFGITKEYLLKVSRDVTARDLETLMAGTVIDGKVVRPVSVKKVRRGTIKIIV
NEGKKHEIRLFAEAAGLQLLELKRIRIGSLVLGGLPYGKYRELTDSELDSCLSGKSVALV
A
Download sequence
Identical sequences A0A0E9FYA2
gi|478468291|ref|YP_007743164.1| 471473.CTLon_0092 gi|478451157|ref|YP_007721599.1| gi|478471891|ref|YP_007740494.1| gi|478467391|ref|YP_007718923.1| gi|478450256|ref|YP_007719813.1| WP_012263549.1.101735 WP_012263549.1.18643 WP_012263549.1.25195 WP_012263549.1.27753 WP_012263549.1.38794 WP_012263549.1.40464 WP_012263549.1.42718 WP_012263549.1.45552 WP_012263549.1.48923 WP_012263549.1.5416 WP_012263549.1.58308 WP_012263549.1.5967 WP_012263549.1.79775 WP_012263549.1.97423 gi|478452957|ref|YP_007720705.1| gi|478464692|ref|YP_007741384.1| gi|478471000|ref|YP_007729641.1| gi|478454762|ref|YP_007717141.1| gi|478453870|ref|YP_007718032.1| gi|478470100|ref|YP_007723380.1| gi|478465592|ref|YP_007742274.1| gi|166154940|ref|YP_001653195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]