SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452974|ref|YP_007720722.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452974|ref|YP_007720722.1|
Domain Number 1 Region: 112-186,216-288
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.09e-29
Family Ferredoxin reductase FAD-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 272-426
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.7e-23
Family Reductases 0.027
Further Details:      
 
Domain Number 3 Region: 45-129
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.09e-19
Family 2Fe-2S ferredoxin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452974|ref|YP_007720722.1|
Sequence length 431
Comment Na(+)-translocating NADH-quinone reductase subunit F [Chlamydia trachomatis L2b/Canada1]
Sequence
MTWLSGLYSIFVASAAFCSLDLILVAVILLSRKFLIKVHPCKLKINNDDSLTKTVDSGKT
LLSSLLDSGIAIPSPCGGKAACKQCKVRITKNADEPLETDRSTFSKQQLEQGWRLSCQTK
VQHDLCLEVEDRYFNASSWEGTVVSNENVATFIKELVLSVDPSRPIPFKPGGYLQITVPP
YKTNTSDWKQTMDPQYYSDWETFHLFDQVIDNLSLDTDSANKAYSLASYPAELPLIKFNV
RIATPSFVDQAPDPTIPWGVCSSYIFSLKPGDKVMVSGPYGESFMKENNRPVIFLIGGAG
SSFGRSHILDLLLNKHSDRELTLWYGARSLKENIYQEEYEKLEKEFPNFHYHLVLSQPLQ
EDLDQGWDKNDPIKTNFLFKAFELGQLSHLPNPEDYLYYVCGPALHNSSILTVLDNYGVE
RSSIVLDDFGS
Download sequence
Identical sequences A0A0E9AW37 A0A0H3MJX9
gi|482546144|ref|YP_007852060.1| gi|478451174|ref|YP_007721616.1| WP_009873341.1.100883 WP_009873341.1.101735 WP_009873341.1.11148 WP_009873341.1.11732 WP_009873341.1.17082 WP_009873341.1.18643 WP_009873341.1.25195 WP_009873341.1.27753 WP_009873341.1.27980 WP_009873341.1.38181 WP_009873341.1.38794 WP_009873341.1.40464 WP_009873341.1.40808 WP_009873341.1.42718 WP_009873341.1.45552 WP_009873341.1.48923 WP_009873341.1.49465 WP_009873341.1.51159 WP_009873341.1.53299 WP_009873341.1.5416 WP_009873341.1.58046 WP_009873341.1.58308 WP_009873341.1.5967 WP_009873341.1.60427 WP_009873341.1.61004 WP_009873341.1.62489 WP_009873341.1.64162 WP_009873341.1.71307 WP_009873341.1.79775 WP_009873341.1.83642 WP_009873341.1.85365 WP_009873341.1.87079 WP_009873341.1.95142 WP_009873341.1.97423 WP_009873341.1.99598 YP_001654200.1.27483 gi|478453887|ref|YP_007718049.1| gi|478463811|ref|YP_007739623.1| gi|166154957|ref|YP_001653212.1| gi|478462913|ref|YP_007738734.1| gi|527320463|ref|YP_008346663.1| gi|527326295|ref|YP_008352488.1| gi|478470117|ref|YP_007723397.1| gi|166154082|ref|YP_001654200.1| gi|478468308|ref|YP_007743181.1| gi|478450273|ref|YP_007719830.1| gi|478452074|ref|YP_007715380.1| gi|478464709|ref|YP_007741401.1| gi|478452974|ref|YP_007720722.1| gi|527324236|ref|YP_008350432.1| gi|478465609|ref|YP_007742291.1| 471472.CTL0109 471473.CTLon_0109 gi|478471017|ref|YP_007729658.1| gi|482545202|ref|YP_007851120.1| gi|339625489|ref|YP_004716968.1| gi|527325369|ref|YP_008351563.1| gi|478467408|ref|YP_007718940.1| gi|478454779|ref|YP_007717158.1| gi|527318587|ref|YP_008344789.1| gi|527328142|ref|YP_008354333.1| gi|478448475|ref|YP_007722509.1| gi|527329068|ref|YP_008355258.1| gi|478447582|ref|YP_007716270.1| gi|478471908|ref|YP_007740511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]