SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452986|ref|YP_007720734.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452986|ref|YP_007720734.1|
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.37e-19
Family eIF5a N-terminal domain-like 0.0044
Further Details:      
 
Domain Number 2 Region: 131-188
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000514
Family Cold shock DNA-binding domain-like 0.00082
Further Details:      
 
Domain Number 3 Region: 67-128
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000557
Family Cold shock DNA-binding domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452986|ref|YP_007720734.1|
Sequence length 190
Comment elongation factor P [Chlamydia trachomatis L2b/Canada1]
Sequence
MVRVSTSEFRVGLRVEIDGQPYVILQNDFVKPGKGQAFNRIKVKNFLTGRVIEKTFKSGE
SIETADVREQQMRLLYTDQEGATFMDDETFEQELIFWDKLENVRQWLLEDTIYTLVLYNG
DVISVEPPIFMELTIAETAPGVRGDTASGRVLKPATTNTGAKIMVPIFIEEGEVVKVDTR
TGSYESRVSK
Download sequence
Identical sequences A0A0E9EEH3
gi|478462925|ref|YP_007738746.1| gi|478452086|ref|YP_007715392.1| gi|527324250|ref|YP_008350446.1| gi|478448487|ref|YP_007722521.1| gi|527326309|ref|YP_008352502.1| gi|478463823|ref|YP_007739635.1| gi|527325383|ref|YP_008351577.1| gi|527329082|ref|YP_008355272.1| gi|527323324|ref|YP_008349521.1| gi|482545216|ref|YP_007851134.1| gi|527318601|ref|YP_008344803.1| gi|478465621|ref|YP_007742303.1| gi|478450285|ref|YP_007719842.1| gi|478467420|ref|YP_007718952.1| gi|478447594|ref|YP_007716282.1| gi|527321431|ref|YP_008347630.1| gi|527320477|ref|YP_008346677.1| gi|478453899|ref|YP_007718061.1| gi|478470129|ref|YP_007723409.1| WP_009873381.1.100883 WP_009873381.1.101735 WP_009873381.1.11148 WP_009873381.1.11732 WP_009873381.1.17082 WP_009873381.1.18643 WP_009873381.1.22210 WP_009873381.1.25195 WP_009873381.1.27753 WP_009873381.1.27980 WP_009873381.1.32801 WP_009873381.1.38181 WP_009873381.1.38794 WP_009873381.1.40464 WP_009873381.1.40808 WP_009873381.1.42718 WP_009873381.1.45552 WP_009873381.1.48923 WP_009873381.1.49465 WP_009873381.1.51159 WP_009873381.1.52091 WP_009873381.1.53299 WP_009873381.1.5416 WP_009873381.1.58046 WP_009873381.1.58308 WP_009873381.1.5967 WP_009873381.1.60427 WP_009873381.1.61004 WP_009873381.1.62489 WP_009873381.1.62510 WP_009873381.1.64162 WP_009873381.1.67104 WP_009873381.1.71307 WP_009873381.1.79775 WP_009873381.1.83642 WP_009873381.1.85365 WP_009873381.1.87079 WP_009873381.1.95142 WP_009873381.1.97423 WP_009873381.1.99598 gi|478464721|ref|YP_007741413.1| gi|478471029|ref|YP_007729670.1| gi|527319558|ref|YP_008345759.1| gi|478471920|ref|YP_007740523.1| gi|527322367|ref|YP_008348565.1| gi|482546158|ref|YP_007852074.1| gi|339625503|ref|YP_004716982.1| gi|478468320|ref|YP_007743193.1| gi|478452986|ref|YP_007720734.1| gi|527327230|ref|YP_008353422.1| gi|478454791|ref|YP_007717170.1| gi|527328156|ref|YP_008354347.1| gi|478451186|ref|YP_007721628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]