SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452990|ref|YP_007720738.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452990|ref|YP_007720738.1|
Domain Number 1 Region: 106-302
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 3.01e-30
Family MurCDEF 0.0036
Further Details:      
 
Domain Number 2 Region: 313-446
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 9.46e-30
Family MurCDEF C-terminal domain 0.0025
Further Details:      
 
Domain Number 3 Region: 18-95
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 1.26e-18
Family MurE/MurF N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478452990|ref|YP_007720738.1|
Sequence length 450
Comment putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase [Chlamydia trachomatis L2b/Canada1]
Sequence
MRPILLEEWSSLLLGMEIPRSGKKVTGVAIDSRLVLPGDVFFALPGNRTSGHLFLKQAAQ
SGAVAAVVASDYHGPSYGLQLLRVADPREALRAAGRTQGALFHGEVIGITGSVGKTTTKN
FANQLLSSVYKVFMSPKSYNSQLTLPLSVLMADGDEDFLLLEMGVSEPNNMKNLLEIIEP
TIGVITHIDVQHAMHFLDKGAQGIVEEKSLLLERCGLQLIPKDSSWFQFFAKKNSAAERF
SFSMSNETADFYYRAIHSEGVLISAPDGDIELPAVFPYSPAYMNFIIAVALAWITNVPMD
RLEQVSQSLFLPAMRFEQQEHNGIRVINDAYNASPDAMLAALDAVPVPPEGGKIIFILGH
MAELGRYSDECHIAVARKAVTKAHIIFFVGEKWFPVRDIVRDADCQIGFYSAVSEIMDTV
KALVQQGDVVLLKGSRSLELETLLPCFSIS
Download sequence
Identical sequences A0A0E9DRU3 A0A0H3MGA7
gi|478454795|ref|YP_007717174.1| gi|478467424|ref|YP_007718956.1| gi|478451190|ref|YP_007721632.1| gi|527322371|ref|YP_008348569.1| gi|478471924|ref|YP_007740527.1| gi|478452090|ref|YP_007715396.1| gi|527319562|ref|YP_008345763.1| gi|478462929|ref|YP_007738750.1| gi|527324254|ref|YP_008350450.1| 471472.CTL0125 471473.CTLon_0125 gi|478471033|ref|YP_007729674.1| gi|478470133|ref|YP_007723413.1| gi|478468324|ref|YP_007743197.1| gi|527320481|ref|YP_008346681.1| gi|478453903|ref|YP_007718065.1| gi|478450289|ref|YP_007719846.1| gi|478463827|ref|YP_007739639.1| gi|527318605|ref|YP_008344807.1| gi|527326313|ref|YP_008352506.1| gi|527321435|ref|YP_008347634.1| gi|482546162|ref|YP_007852078.1| gi|527328160|ref|YP_008354351.1| gi|482545220|ref|YP_007851138.1| gi|166154973|ref|YP_001653228.1| gi|478464725|ref|YP_007741417.1| gi|527327234|ref|YP_008353426.1| gi|527323328|ref|YP_008349525.1| gi|478452990|ref|YP_007720738.1| gi|478447598|ref|YP_007716286.1| gi|527325387|ref|YP_008351581.1| gi|527329086|ref|YP_008355276.1| gi|478448491|ref|YP_007722525.1| gi|339625507|ref|YP_004716986.1| WP_009873383.1.100883 WP_009873383.1.101735 WP_009873383.1.11148 WP_009873383.1.11732 WP_009873383.1.17082 WP_009873383.1.18643 WP_009873383.1.22210 WP_009873383.1.25195 WP_009873383.1.27753 WP_009873383.1.27980 WP_009873383.1.32801 WP_009873383.1.38794 WP_009873383.1.40464 WP_009873383.1.40808 WP_009873383.1.42718 WP_009873383.1.45552 WP_009873383.1.48923 WP_009873383.1.49465 WP_009873383.1.51159 WP_009873383.1.52091 WP_009873383.1.53299 WP_009873383.1.5416 WP_009873383.1.58046 WP_009873383.1.58308 WP_009873383.1.5967 WP_009873383.1.60427 WP_009873383.1.61004 WP_009873383.1.62489 WP_009873383.1.62510 WP_009873383.1.64162 WP_009873383.1.67104 WP_009873383.1.71307 WP_009873383.1.79775 WP_009873383.1.83642 WP_009873383.1.85365 WP_009873383.1.87079 WP_009873383.1.95142 WP_009873383.1.97423 WP_009873383.1.99598 YP_001654216.1.27483 gi|478465625|ref|YP_007742307.1| gi|166154098|ref|YP_001654216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]